DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and Zfp174

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001074686.1 Gene:Zfp174 / 385674 MGIID:2686600 Length:407 Species:Mus musculus


Alignment Length:424 Identity:96/424 - (22%)
Similarity:153/424 - (36%) Gaps:101/424 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TASTRLD----QMLHICAGIPVSLDDN--------FPDKMCSK----------------CVRCL- 68
            |.||..:    |..||.    :.|::|        :||...|:                .:.|| 
Mouse     8 TLSTHTEDSDKQERHII----MKLEENRGPPQQKAYPDPELSRQGFRHFCYQEVSGPQEALSCLQ 68

  Fly    69 RLCYKFRLTCQRSHQHIMDML-------------DREASNANAAGEGDLLSIAEDLSVESVL-KS 119
            :||.::......:.:.|:::|             ..:..:.......:::::.|||...|.. |.
Mouse    69 QLCRQWLQPELHTKEQILELLVMEQFLVILPPEIQAQVWHRYPKSSREIVTLVEDLHRTSKKPKQ 133

  Fly   120 WEDYASQ-------LDGGMKVEGE-EDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNE----I 172
            |.....|       ..|...||.| .|.|.|..:..:::...::.:....|:...|...|    .
Mouse   134 WVTVCMQGQKVLLEKTGAQLVEQELRDFQPQTPSRDIQEDSLEEPSCEGSHEQLSPHHWEKTVLQ 198

  Fly   173 EEAETYAEYEEYELLTNENSPEIAQEKGSTGTDVATEEP-------PEEEIAEDILDSDEDYDPT 230
            |......|.|...:..::.:|:..:.:|:....|....|       ||   ...:..||......
Mouse   199 EPVLRLTETESSRMRGDKENPKQEEARGAKACTVLHGRPKGGTLHSPE---PRGVTASDARLLQW 260

  Fly   231 HAKPEKCDRSGRKPVAYH--------------KNSPKVETFKKKVGRKPRNKLSTYICDVCGNIY 281
            ..:|.:..:|    :|::              :..|..|..:.:.||  |..||..:        
Mouse   261 QVRPPQSPKS----LAHYQKHCRELEYISNPLRGHPLRELKRSRGGR--RRSLSGLL-------- 311

  Fly   282 PTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKH 346
                :...|...|...||:.||.||:.|..|.:|.||...|||.|||.|..|...|..:||...|
Mouse   312 ----QCLGHQAAHPAKKPYSCEDCGKNFTWNSELKRHRRVHTGERPYICGECGNCFGRQSTLKLH 372

  Fly   347 HRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTG 380
            .||||.|:||.|..|.:.|..|.||..|..:|.|
Mouse   373 QRIHTGEKPYQCSHCGKCFRQSSNLHQHHRLHHG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 16/82 (20%)
COG5048 <264..411 CDD:227381 44/117 (38%)
C2H2 Zn finger 274..294 CDD:275368 1/19 (5%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 9/19 (47%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 5/11 (45%)
C2H2 Zn finger 386..406 CDD:275368
Zfp174NP_001074686.1 SCAN 42..152 CDD:128708 15/109 (14%)
SCAN 42..130 CDD:280241 11/87 (13%)
C2H2 Zn finger 328..348 CDD:275368 9/19 (47%)
zf-H2C2_2 340..365 CDD:290200 12/24 (50%)
COG5048 352..>407 CDD:227381 25/55 (45%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
zf-H2C2_2 369..393 CDD:290200 11/23 (48%)
C2H2 Zn finger 384..404 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.