DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and Ovol3

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001276746.1 Gene:Ovol3 / 381867 MGIID:2388075 Length:189 Species:Mus musculus


Alignment Length:184 Identity:55/184 - (29%)
Similarity:80/184 - (43%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 EPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETF----KKKVGRKPRNKLS 270
            :||......|.|..|. |.|      .|......|.  |::|...:|:    :..:...|:.. .
Mouse    13 QPPNWSHLPDQLRGDA-YVP------DCSSLAVPPA--HRSSGLRDTWAVSSQGTLTSAPKGP-G 67

  Fly   271 TYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPA 335
            |..|.:|...:|.|..||.|:|.||..:.|.|..||:||.....|.|||.||||.||::|..|..
Mouse    68 TLGCPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMRTHTGIRPFRCGACGK 132

  Fly   336 AFADRSTKTKH-HRIH----------TKERPYVCDVCSRTFTYSDNLKFHKMIH 378
            ||..|.:...| .::|          .:|:.:||:.|..|.:..|....|:.:|
Mouse   133 AFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDAYAQHRTLH 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 43/126 (34%)
C2H2 Zn finger 274..294 CDD:275368 8/19 (42%)
zf-H2C2_2 287..311 CDD:290200 12/23 (52%)
C2H2 Zn finger 302..322 CDD:275368 9/19 (47%)
zf-H2C2_2 315..338 CDD:290200 13/22 (59%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
zf-H2C2_2 345..367 CDD:290200 7/32 (22%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 2/9 (22%)
C2H2 Zn finger 386..406 CDD:275368
Ovol3NP_001276746.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 2/6 (33%)
C2H2 Zn finger 71..91 CDD:275368 8/19 (42%)
zf-C2H2 97..119 CDD:395048 10/21 (48%)
C2H2 Zn finger 99..119 CDD:275368 9/19 (47%)
zf-H2C2_2 111..136 CDD:404364 14/24 (58%)
C2H2 Zn finger 127..148 CDD:275368 6/20 (30%)
C2H2 Zn finger 166..186 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.