| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001276749.1 | Gene: | Ovol3 / 365226 | RGDID: | 1583800 | Length: | 190 | Species: | Rattus norvegicus |
| Alignment Length: | 208 | Identity: | 64/208 - (30%) |
|---|---|---|---|
| Similarity: | 84/208 - (40%) | Gaps: | 43/208 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 210 EPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFK-------KKVGRKPRN 267
Fly 268 KLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNY 332
Fly 333 CPAAFADRSTKTKH-HRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCG--KGFV 394
Fly 395 KAYKLR--LHRET 405 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 50/147 (34%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 13/22 (59%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 3/22 (14%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 7/25 (28%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 9/24 (38%) | ||
| Ovol3 | NP_001276749.1 | COG5048 | <19..>127 | CDD:227381 | 40/120 (33%) |
| C2H2 Zn finger | 71..91 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 97..119 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 99..119 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 111..136 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 127..148 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 166..186 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||