DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and CG15436

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:406 Identity:96/406 - (23%)
Similarity:156/406 - (38%) Gaps:89/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VCRVCLNNPSEGEELLHDIFSETASTRLD--QMLHICAGIPVSLDDNFPDKMCSKCVRCLRLCYK 73
            :||||::...:    |.:||.....||:.  :|:..|.|..|...|.|.:.:|.:|...::..|.
  Fly     4 ICRVCMDISGK----LVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYG 64

  Fly    74 FRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSWEDYASQLDGGMKVEGEED 138
            .|.||:.|||....:.|....:|       |.::.|:       :.||           :..:||
  Fly    65 IRQTCEESHQFYCRVRDEGIEDA-------LCALLEE-------EDWE-----------ISEDED 104

  Fly   139 QQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTG 203
            .:....:...:||.:|...:            ..|..|.:.:|               |.||   
  Fly   105 ARIDSASAADDDGKSDSKKV------------AFECRECHKKY---------------QRKG--- 139

  Fly   204 TDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRK-PVAYHKNSPKVETFKKKVGRKPRN 267
                                      |..:..:....|:. |..|.|.:.::.. ..|...|..|
  Fly   140 --------------------------TFLRHMRTHMDGQSFPCPYCKRNFRLRV-TLKAHMKTHN 177

  Fly   268 KLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNY 332
            ....|.|..|...:..|:.|..|.:.|:|.:|.:|..|.:.|:::..|.||:.||...||:||:.
  Fly   178 AAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSK 242

  Fly   333 CPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAY 397
            |...|..:.....|.|.||.|||:.|..|.:.|....:||.|..:|..::|..|..|.|.|..:.
  Fly   243 CTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSS 307

  Fly   398 KLRLHRETHNRRITWR 413
            .|:.|:..||...|::
  Fly   308 TLKEHKLVHNAERTFK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 24/77 (31%)
COG5048 <264..411 CDD:227381 48/146 (33%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 24/77 (31%)
C2H2 Zn finger 128..148 CDD:275368 6/63 (10%)
C2H2 Zn finger 156..176 CDD:275368 4/20 (20%)
COG5048 <180..341 CDD:227381 47/144 (33%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
zf-H2C2_2 197..219 CDD:290200 7/21 (33%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..249 CDD:290200 11/24 (46%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-H2C2_2 252..276 CDD:290200 9/23 (39%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
C2H2 Zn finger 324..341 CDD:275368 96/406 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.