| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008758360.2 | Gene: | Ovol1 / 309164 | RGDID: | 1306956 | Length: | 272 | Species: | Rattus norvegicus |
| Alignment Length: | 204 | Identity: | 62/204 - (30%) |
|---|---|---|---|
| Similarity: | 81/204 - (39%) | Gaps: | 36/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 205 DVATEEPPEEEIAEDILDSDEDY-------DPTHAKPEKCDRSGRKPVAYHKNSPKVE------- 255
Fly 256 TFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMN 320
Fly 321 THTGNRPYKCNYCPAAFADRSTKTKH-HRIH-------TKERP---YVCDVCSRTFTYSDNLKFH 374
Fly 375 KMIHTGEKP 383 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 49/131 (37%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 11/32 (34%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 3/14 (21%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | |||
| Ovol1 | XP_008758360.2 | C2H2 Zn finger | 125..145 | CDD:275368 | 7/19 (37%) |
| C2H2 Zn finger | 153..173 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 165..190 | CDD:404364 | 15/24 (63%) | ||
| C2H2 Zn finger | 181..202 | CDD:275368 | 6/20 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||