Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094068.1 | Gene: | ZNF707 / 286075 | HGNCID: | 27815 | Length: | 371 | Species: | Homo sapiens |
Alignment Length: | 222 | Identity: | 69/222 - (31%) |
---|---|---|---|
Similarity: | 96/222 - (43%) | Gaps: | 45/222 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 LDSDEDYDPTHAKPEKCDRSGRKPVAYHKNSPKVETFKKKVGRKP----RNKLS----TYICDVC 277
Fly 278 GNIYPTQARLTEHMKFHSGVKPHE----------------------------CEICGRGFVQNQQ 314
Fly 315 LVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHT 379
Fly 380 GEKPHVCDLCGKGFVKAYKLRLHRETH 406 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
COG5048 | <264..411 | CDD:227381 | 56/179 (31%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 11/51 (22%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/19 (37%) | ||
ZNF707 | NP_001094068.1 | KRAB | 8..68 | CDD:214630 | |
KRAB | 8..47 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..143 | 8/20 (40%) | |||
C2H2 Zn finger | 178..198 | CDD:275368 | 6/19 (32%) | ||
COG5048 | <187..366 | CDD:227381 | 49/152 (32%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 218..242 | CDD:290200 | 4/23 (17%) | ||
C2H2 Zn finger | 234..254 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 260..282 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 274..299 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 290..310 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 302..325 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |