DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and Zkscan17

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_766529.3 Gene:Zkscan17 / 268417 MGIID:2679270 Length:585 Species:Mus musculus


Alignment Length:349 Identity:80/349 - (22%)
Similarity:130/349 - (37%) Gaps:84/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EDYASQL-------DGGMKVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETY 178
            ||||..:       ..|...|.|...:....|..::|.:....:..|: ...||.     :.|..
Mouse   252 EDYAVSMPPNEPPVQPGHSHEEENGLRVTEWTTDLQDKEIPQASCLDL-SSLQPF-----QGEER 310

  Fly   179 AEYEEYELLTNENSPEI--AQEKGSTGTDVATEEPP-------EEEIAEDILDSDEDYDPTHAKP 234
            .::||.::...:..|::  :|.....|.|     ||       :|...|.:|.|..|.|..|:  
Mouse   311 RKWEELQVPELQPCPQVVLSQSPCPAGGD-----PPALKSSLDQEVTIEIVLSSSGDEDSQHS-- 368

  Fly   235 EKCDRSGRKP------VAYHKNSP----KVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTE 289
            ..|....|.|      |..|:::.    :|:|.:|           :|:|..||.|:..:.....
Mouse   369 PYCTEELRSPPEDLHSVPAHQSNASAEGEVQTSQK-----------SYVCPNCGKIFRWRVNFIR 422

  Fly   290 HMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIH---T 351
            |::.....|||:|.:||..|..::.|..|:.||...:||:|..|..:|...|....|.|||   .
Mouse   423 HLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKPYRCTACGKSFRLNSHLISHRRIHLQPA 487

  Fly   352 KERP----------------------------YVCDVCSRTFTYSDNLKFHKM---IHTGEKPHV 385
            .::|                            :.|..|.::|...|:|..|:.   :....:|..
Mouse   488 SQQPMKKSEEEALETEGTGASDLLEKSKAKLSFQCGDCEKSFQRHDHLVRHRRHCHLKDETRPFQ 552

  Fly   386 CDLCGKGFVKAYKLRLHRETHNRR 409
            |..|.|.|.:.|.|..|...|.:|
Mouse   553 CRYCVKTFRQNYDLLRHERLHMKR 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 44/180 (24%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 8/22 (36%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 8/52 (15%)
C2H2 Zn finger 358..378 CDD:275368 6/22 (27%)
zf-H2C2_2 370..394 CDD:290200 6/26 (23%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
Zkscan17NP_766529.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
SCAN 50..124 CDD:396558
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..167
KRAB_A-box 221..>249 CDD:413388
COG5048 <337..573 CDD:227381 61/253 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..397 9/40 (23%)
C2H2 Zn finger 407..427 CDD:275368 5/19 (26%)
C2H2 Zn finger 435..455 CDD:275368 6/19 (32%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..506 2/22 (9%)
C2H2 Zn finger 522..543 CDD:275368 6/20 (30%)
C2H2 Zn finger 553..573 CDD:275368 7/19 (37%)
Nuclear localization signal 575..579 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.