DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ace2

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:282 Identity:63/282 - (22%)
Similarity:98/282 - (34%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FDVHDPTQPVPNEIEEAET---------YAEYEEYELLTNENSPEIAQEKGSTGTDV-------- 206
            |.:..|:...|.::...||         :|:..:.| .|:...|..|.:...:..||        
pombe   250 FQISQPSPAHPVDLSSPETAPNISPVSPFAQLVKLE-PTSPQKPSFALDSSFSHLDVCRHTDNQK 313

  Fly   207 --ATEEPPEEEIAE------------DILDSDEDYDPTH--------------AKPEKC------ 237
              |....|.|.::|            ||.:::.:...|.              .|||.|      
pombe   314 AFAKLSSPAEYVSEFEKFSSVCDHGLDISNANINNTLTQQFALSAPYESCIVTKKPEPCITVKEE 378

  Fly   238 ----------DRSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYIC----DVCGNIYPTQARLT 288
                      |.|....|..|.:.|.|......  |....|.||.||    :...::|.......
pombe   379 EQLAPKIESADLSITPQVTEHDSKPPVRISYDH--RCKTRKQSTRICRIPPETMASLYCGPEADG 441

  Fly   289 EHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
            :::..::|        |.:...:...:..|:.||..:|||:|:.|.|.|.......:|.|||...
pombe   442 KYVCLYNG--------CNKRIARKYNVESHIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENG 498

  Fly   354 RPYVCDVCSRTFTYSDNLKFHK 375
            |||||: |.:.|...|.|..||
pombe   499 RPYVCE-CLKRFNRLDALNRHK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 33/116 (28%)
C2H2 Zn finger 274..294 CDD:275368 2/23 (9%)
zf-H2C2_2 287..311 CDD:290200 2/23 (9%)
C2H2 Zn finger 302..322 CDD:275368 2/19 (11%)
zf-H2C2_2 315..338 CDD:290200 9/22 (41%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 7/18 (39%)
zf-H2C2_2 370..394 CDD:290200 3/6 (50%)
C2H2 Zn finger 386..406 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 61/279 (22%)
C2H2 Zn finger 448..467 CDD:275368 3/26 (12%)
zf-C2H2 473..495 CDD:278523 7/21 (33%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.