DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and Zfp809

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_766351.3 Gene:Zfp809 / 235047 MGIID:2143362 Length:402 Species:Mus musculus


Alignment Length:389 Identity:90/389 - (23%)
Similarity:152/389 - (39%) Gaps:100/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EDLSVESVLKSWEDYASQLDGGMKVEGEEDQQHQVITYVVED---------------------GD 152
            ||::|:..|:.|:|    ||...:....:.......:.|..|                     .:
Mouse     7 EDVAVDFTLEEWQD----LDAAQRTLYRDVMLETYSSLVFLDPCIAKPKLIFNLERGFGPWSLAE 67

  Fly   153 TDDTNMFDVH------DPTQPVP-NEIEEAETYAEYEEYELLTNENSP-------EI-AQEKGST 202
            ....::..||      |.::.:| ..:.:...          ||:.:|       |: |:::.|.
Mouse    68 ASSRSLPGVHNVSTLSDTSKKIPKTRLRQLRK----------TNQKTPSEDTIEAELKARQEVSK 122

  Fly   203 GTDVATEEPPEEEI-----------------------AEDILDSD----EDYDPTH--AKPEKCD 238
            ||.......|.:.:                       .|.:..::    :.|..||  .||.:||
Mouse   123 GTTSRHRRAPVKSLCRKSQRTKNQTSYNDGNLYECKDCEKVFCNNSTLIKHYRRTHNVYKPYECD 187

  Fly   239 RSGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECE 303
            ...:  :.|.|:.   .|..:|..|: |.::  |.|..||..:..::.|..|.:.|||.||:||.
Mouse   188 ECSK--MYYWKSD---LTSHQKTHRQ-RKRI--YECSECGKAFFRKSHLNAHERTHSGEKPYECT 244

  Fly   304 ICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYS 368
            .|.:.|.....|.||..||.|.:|:||..|..||:.:|....|.:.||.|:||.|..|.:.|::.
Mouse   245 ECRKAFYYKSDLTRHKKTHLGEKPFKCEECKKAFSRKSKLAIHQKKHTGEKPYECTECKKAFSHQ 309

  Fly   369 DNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHN----------RRIT---WRNDAEES 419
            ..|..|::.|:.|.|:.|..|.|.|....:|..|::.|.          ::||   |..:..|:
Mouse   310 SQLTAHRIAHSSENPYECKECNKSFHWKCQLTAHQKRHTGVTYFQEVVFQQITVSDWTGNLSEN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 50/156 (32%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 9/21 (43%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
Zfp809NP_766351.3 KRAB 4..64 CDD:214630 10/60 (17%)
KRAB 4..43 CDD:279668 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..139 4/20 (20%)
COG5048 <125..348 CDD:227381 63/230 (27%)
C2H2 Zn finger 157..178 CDD:275368 2/20 (10%)
C2H2 Zn finger 186..206 CDD:275368 6/24 (25%)
zf-C2H2 213..235 CDD:278523 6/21 (29%)
C2H2 Zn finger 215..235 CDD:275368 5/19 (26%)
zf-H2C2_2 227..252 CDD:290200 11/24 (46%)
C2H2 Zn finger 243..263 CDD:275368 6/19 (32%)
zf-H2C2_2 255..280 CDD:290200 12/24 (50%)
C2H2 Zn finger 271..291 CDD:275368 6/19 (32%)
zf-H2C2_2 284..308 CDD:290200 9/23 (39%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.