DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and znf-782

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_500033.1 Gene:znf-782 / 190310 WormBaseID:WBGene00021931 Length:662 Species:Caenorhabditis elegans


Alignment Length:374 Identity:86/374 - (22%)
Similarity:124/374 - (33%) Gaps:145/374 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DVHDPTQPVPNEIEEAETYAEYEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAE---DIL 221
            |.|.||                     .||...|:          |:..::|.|||..|   ::|
 Worm     4 DYHQPT---------------------TTNTTLPD----------DIHMKDPEEEEFEEYEDELL 37

  Fly   222 DSDEDYDPTHAKPEKCDRSGRKPVA-----------YHKNSPKVETFKKKVGR--------KPRN 267
            :.:|::|....:.|..|.:.....|           .|.:||.::......|.        :|..
 Worm    38 EEEEEFDEELEELENSDSASSLVSAGSPHGSSSSNGSHGSSPPLQVQSPSQGSGSSGSPTGQPEK 102

  Fly   268 KLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNY 332
            :   :||.|||..:...:.|..|.:.|:|.||:.|..|.:.|.|...|..|..||||.|||||.|
 Worm   103 R---HICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRY 164

  Fly   333 CPAAFADRSTKTKHH-------------------------------------------------- 347
            |...||...|||.|.                                                  
 Worm   165 CEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKN 229

  Fly   348 ------------------------------------RIHTKERPYVCDVCSRTFTYSDNLKFHKM 376
                                                |.||.||||||..|.:.|....||:.|:.
 Worm   230 YLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHER 294

  Fly   377 IHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAEDV 425
            .||||:|:.|..|.:.|::..:|..|..||   :|.::.....:...|:
 Worm   295 THTGERPYSCQFCQRTFIQKSQLTAHESTH---LTQKHSVNPDSTTADI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 61/232 (26%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 9/23 (39%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 13/22 (59%)
C2H2 Zn finger 330..350 CDD:275368 10/105 (10%)
zf-H2C2_2 345..367 CDD:290200 12/107 (11%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 10/23 (43%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
znf-782NP_500033.1 C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
zf-H2C2_2 119..143 CDD:290200 9/23 (39%)
C2H2 Zn finger 134..154 CDD:275368 6/19 (32%)
zf-H2C2_2 147..171 CDD:290200 14/23 (61%)
C2H2 Zn finger 162..180 CDD:275368 9/17 (53%)
COG5048 <187..404 CDD:227381 28/157 (18%)
C2H2 Zn finger 191..211 CDD:275370 0/19 (0%)
C2H2 Zn finger 218..239 CDD:275368 0/20 (0%)
C2H2 Zn finger 248..268 CDD:275368 1/19 (5%)
zf-H2C2_2 260..285 CDD:290200 11/24 (46%)
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 288..313 CDD:290200 11/24 (46%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 386..403 CDD:275368
C2H2 Zn finger 424..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.