| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_064319.1 | Gene: | Ovol1 / 18426 | MGIID: | 1330290 | Length: | 267 | Species: | Mus musculus |
| Alignment Length: | 204 | Identity: | 65/204 - (31%) |
|---|---|---|---|
| Similarity: | 86/204 - (42%) | Gaps: | 42/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 205 DVATEEPPEEEIAEDILDSDEDYDPTHAKPEKC--------DRSGRKPVAYHKNSPKVE------ 255
Fly 256 -TFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHM 319
Fly 320 NTHTGNRPYKCNYCPAAFADRSTKTKH-HRIH-------TKERP---YVCDVCSRTFTYSDNLKF 373
Fly 374 HKMIHTGEK 382 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 50/130 (38%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 11/32 (34%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 3/13 (23%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | |||
| Ovol1 | NP_064319.1 | zf-C2H2 | 118..138 | CDD:333835 | 6/21 (29%) |
| C2H2 Zn finger | 120..140 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 148..168 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 160..185 | CDD:372612 | 15/24 (63%) | ||
| C2H2 Zn finger | 176..197 | CDD:275368 | 6/20 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||