DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and C04F5.9

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_504371.1 Gene:C04F5.9 / 178899 WormBaseID:WBGene00015451 Length:534 Species:Caenorhabditis elegans


Alignment Length:185 Identity:46/185 - (24%)
Similarity:56/185 - (30%) Gaps:74/185 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KPHECEICGRGFVQNQQLVRHMNTH--TGNRPYKCNYCPAAFADRSTKTKHHRIH-TKERPYVCD 359
            |.|.|..|...|....:|.||:.||  ||. .:.|..|...|...|:.|.|.|.. .|.:...||
 Worm     3 KDHRCPQCLLEFPFASKLQRHLETHLITGG-DWLCGLCDTLFNRSSSLTNHWRNSCAKVKMAFCD 66

  Fly   360 ----------------------------------VCSRTFTYSDN----------------LKFH 374
                                              ..|...|.||:                |..|
 Worm    67 DELKEMLVYDLREAVFRMTLDHYSASEKSPEEPGTSSSYKTASDDKTSICIYCNLLMPRGTLHHH 131

  Fly   375 KMIHTGE-----------KPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEE 418
            ..:|||.           .|:||||||.||  .||..|:..       ||:...|
 Worm   132 YSVHTGRCCPAEITQNSVVPYVCDLCGFGF--RYKKSLYNH-------WRHKCTE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 43/176 (24%)
C2H2 Zn finger 274..294 CDD:275368
zf-H2C2_2 287..311 CDD:290200 5/12 (42%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 6/56 (11%)
C2H2 Zn finger 358..378 CDD:275368 8/69 (12%)
zf-H2C2_2 370..394 CDD:290200 13/50 (26%)
C2H2 Zn finger 386..406 CDD:275368 10/19 (53%)
C04F5.9NP_504371.1 C2H2 Zn finger 7..27 CDD:275368 6/19 (32%)
C2H2 Zn finger 36..54 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.