DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZNF679

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_699194.2 Gene:ZNF679 / 168417 HGNCID:28650 Length:411 Species:Homo sapiens


Alignment Length:201 Identity:75/201 - (37%)
Similarity:102/201 - (50%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 THAKPEKCDRSGRKP------VAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLT 288
            |.....:|:..| ||      ::.||   ::.|     |.||      |.|:.||..:...:.||
Human   207 TRENSYQCEECG-KPFNCSSTLSKHK---RIHT-----GEKP------YRCEECGKAFTWSSTLT 256

  Fly   289 EHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
            :|.:.|:|.||:.||.||:.|.::..|..|...|||.:||.|..|..||:..|:.|.|.||||.|
Human   257 KHRRIHTGEKPYTCEECGQAFSRSSTLANHKRIHTGEKPYTCEECGKAFSLSSSLTYHKRIHTGE 321

  Fly   354 RPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEE 418
            :||.|:.|.:.|..|..||.||:|||||||:.|..|||.|..:..|..|:..|.        .||
Human   322 KPYTCEECGKAFNCSSTLKKHKIIHTGEKPYKCKECGKAFAFSSTLNTHKRIHT--------GEE 378

  Fly   419 STKAED 424
            ..|.|:
Human   379 PYKCEE 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 62/146 (42%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 12/23 (52%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 10/22 (45%)
C2H2 Zn finger 330..350 CDD:275368 8/19 (42%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
zf-H2C2_2 370..394 CDD:290200 15/23 (65%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZNF679NP_699194.2 KRAB 16..76 CDD:214630
KRAB 16..55 CDD:279668
C2H2 Zn finger 159..178 CDD:275368
C2H2 Zn finger 186..206 CDD:275368
C2H2 Zn finger 214..234 CDD:275368 6/23 (26%)
zf-H2C2_2 227..250 CDD:290200 10/36 (28%)
COG5048 <238..401 CDD:227381 66/161 (41%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 255..279 CDD:290200 12/23 (52%)
C2H2 Zn finger 270..290 CDD:275368 7/19 (37%)
zf-H2C2_2 283..306 CDD:290200 10/22 (45%)
C2H2 Zn finger 298..318 CDD:275368 8/19 (42%)
zf-H2C2_2 310..335 CDD:290200 12/24 (50%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
zf-H2C2_2 339..362 CDD:290200 15/22 (68%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..390 CDD:290200 7/26 (27%)
C2H2 Zn finger 382..402 CDD:275368 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.