Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_699194.2 | Gene: | ZNF679 / 168417 | HGNCID: | 28650 | Length: | 411 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 75/201 - (37%) |
---|---|---|---|
Similarity: | 102/201 - (50%) | Gaps: | 29/201 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 THAKPEKCDRSGRKP------VAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLT 288
Fly 289 EHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKE 353
Fly 354 RPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEE 418
Fly 419 STKAED 424 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
COG5048 | <264..411 | CDD:227381 | 62/146 (42%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 15/23 (65%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/19 (37%) | ||
ZNF679 | NP_699194.2 | KRAB | 16..76 | CDD:214630 | |
KRAB | 16..55 | CDD:279668 | |||
C2H2 Zn finger | 159..178 | CDD:275368 | |||
C2H2 Zn finger | 186..206 | CDD:275368 | |||
C2H2 Zn finger | 214..234 | CDD:275368 | 6/23 (26%) | ||
zf-H2C2_2 | 227..250 | CDD:290200 | 10/36 (28%) | ||
COG5048 | <238..401 | CDD:227381 | 66/161 (41%) | ||
C2H2 Zn finger | 242..262 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 255..279 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 270..290 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 283..306 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 298..318 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 310..335 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 339..362 | CDD:290200 | 15/22 (68%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 367..390 | CDD:290200 | 7/26 (27%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 1/3 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |