DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZNF610

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001154897.1 Gene:ZNF610 / 162963 HGNCID:26687 Length:462 Species:Homo sapiens


Alignment Length:376 Identity:100/376 - (26%)
Similarity:152/376 - (40%) Gaps:84/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DLSVESVLKSWED---YASQLDGGMKVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNE 171
            |||:.|:||...:   ..||:......:|.|         .|...:|..:.:...:...:|:.|:
Human    69 DLSIISMLKQRREPLILQSQVKIVKNTDGRE---------CVRSVNTGRSCVLGSNAENKPIKNQ 124

  Fly   172 --------IEEAETYA------EYEEYELLTNENSPEIAQEKGSTG--TDVATEE---------- 210
                    :.|.:.:.      ...:.|..||..|.....:|.|:.  |.:..:.          
Human   125 LGLTLEAHLSELQLFQAGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLL 189

  Fly   211 PPEE-----------EIAED-----ILDSDEDYDPTHA--KPEKCDRSGRKPVAYHKNSPKVETF 257
            |.||           |.:||     :..|..::...|.  ||.||...|:   .:.:||..||.:
Human   190 PQEEKAYIRGKSYEYECSEDGEVFRVRASLTNHQVIHTAEKPYKCTECGK---VFSRNSHLVEHW 251

  Fly   258 KKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTH 322
            :...|:||      |.|..|..::...:.|..|.:.|:|.|||:|..||:.|.:...|..|:..|
Human   252 RIHTGQKP------YKCSECDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFRECSGLTTHLVIH 310

  Fly   323 TGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCD 387
            ||.:|||||.|...|..:.:.|.|.|.||.|:||.|:.|.:.|:....|..|::||:.|||:.|:
Human   311 TGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECGKVFSLLSYLARHQIIHSTEKPYKCN 375

  Fly   388 LCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAEDVKGETPEFLNELPK 438
            .||:.|.|...|..|...|.                   ||.|...||..|
Human   376 ECGRAFHKRPGLMAHLLIHT-------------------GEKPYKCNECDK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 54/146 (37%)
C2H2 Zn finger 274..294 CDD:275368 4/19 (21%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 10/23 (43%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZNF610NP_001154897.1 KRAB 24..82 CDD:214630 6/12 (50%)
KRAB 24..63 CDD:279668
C2H2 Zn finger 206..226 CDD:275368 3/19 (16%)
COG5048 217..>291 CDD:227381 24/82 (29%)
zf-H2C2_2 218..243 CDD:290200 7/27 (26%)
C2H2 Zn finger 234..254 CDD:275368 6/22 (27%)
zf-H2C2_2 246..271 CDD:290200 8/30 (27%)
COG5048 <257..446 CDD:227381 60/176 (34%)
zf-C2H2 260..282 CDD:278523 5/21 (24%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
zf-H2C2_2 274..297 CDD:290200 10/22 (45%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 303..327 CDD:290200 12/23 (52%)
zf-C2H2 316..338 CDD:278523 9/21 (43%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
zf-H2C2_2 330..354 CDD:290200 10/23 (43%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)
zf-H2C2_2 358..382 CDD:290200 10/23 (43%)
C2H2 Zn finger 374..394 CDD:275368 7/19 (37%)
zf-H2C2_2 387..411 CDD:290200 9/40 (23%)
C2H2 Zn finger 402..422 CDD:275368 3/6 (50%)
zf-H2C2_2 414..439 CDD:290200
C2H2 Zn finger 430..450 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.