DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZNF570

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001287922.1 Gene:ZNF570 / 148268 HGNCID:26416 Length:592 Species:Homo sapiens


Alignment Length:421 Identity:106/421 - (25%)
Similarity:164/421 - (38%) Gaps:97/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DNFPDKMCSKCVRCLRLCYKFRLTCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDL--SVESV 116
            |.:.:....|.:..| ..|....:..|.........:|:..|..|..:.::::..|.|  ..|..
Human   157 DFYEEHQSQKIIETL-TSYNLEYSSLREEWKCEGYFERQPGNQKACFKEEIITHEEPLFDEREQE 220

  Fly   117 LKSWEDY-ASQLDGGMKVEGEEDQQHQVITYVVEDGDT--------------------------- 153
            .|||..: .:.|....|:..:|::.|:        .||                           
Human   221 YKSWGSFHQNPLLCTQKIIPKEEKVHK--------HDTQKRSFKKNLMAIKPKSVCAEKKLLKCN 277

  Fly   154 DDTNMFD----------VHDPTQPVP-----------------NEIEEAETYAEYEEYELLTNEN 191
            |...:|.          :|...:|..                 ..|...|...|.:|.....::|
Human   278 DCEKVFSQSSSLTLHQRIHTGEKPYKCIECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQN 342

  Fly   192 SPEIAQEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTH------AKPEKCDRSG-----RKPV 245
            :..:...:..||     |:|.|.::..... |...|...|      .||.:|...|     |..:
Human   343 AHLVQHLRVHTG-----EKPYECKVCRKAF-SQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSI 401

  Fly   246 AYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFV 310
            |.|:   :|.|     |.||      |.|:|||..:..:|.||.|.:.|:|.:|:||:.||:.|.
Human   402 AQHQ---RVHT-----GEKP------YECNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFS 452

  Fly   311 QNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHK 375
            ||..|.:|...|||.:||||..|..||:..:...:|.|:||.|:||.|..|.:.|:...:|..|:
Human   453 QNSHLAQHQRIHTGEKPYKCQECRKAFSQIAYLAQHQRVHTGEKPYECIECGKAFSNDSSLTQHQ 517

  Fly   376 MIHTGEKPHVCDLCGKGFVKAYKLRLHRETH 406
            .:||||||:.|.:|||.|.....|..|:..|
Human   518 RVHTGEKPYECTVCGKAFSYCGSLAQHQRIH 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 5/32 (16%)
COG5048 <264..411 CDD:227381 59/143 (41%)
C2H2 Zn finger 274..294 CDD:275368 8/19 (42%)
zf-H2C2_2 287..311 CDD:290200 11/23 (48%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 12/23 (52%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZNF570NP_001287922.1 KRAB 70..130 CDD:214630
C2H2 Zn finger 276..296 CDD:275368 2/19 (11%)
zf-H2C2_2 288..313 CDD:316026 2/24 (8%)
C2H2 Zn finger 304..324 CDD:275368 0/19 (0%)
COG5048 <307..572 CDD:227381 82/262 (31%)
C2H2 Zn finger 332..352 CDD:275368 2/19 (11%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 388..408 CDD:275368 5/22 (23%)
C2H2 Zn finger 416..436 CDD:275368 8/19 (42%)
C2H2 Zn finger 444..464 CDD:275368 8/19 (42%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
C2H2 Zn finger 500..520 CDD:275368 5/19 (26%)
C2H2 Zn finger 528..548 CDD:275368 7/19 (37%)
C2H2 Zn finger 556..576 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.