DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZSCAN29

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001359009.1 Gene:ZSCAN29 / 146050 HGNCID:26673 Length:852 Species:Homo sapiens


Alignment Length:347 Identity:93/347 - (26%)
Similarity:133/347 - (38%) Gaps:97/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VEDGDTDDTNMF-----------------DVHDPTQPVPNE-IEEAETYAEYEEYELLTNENS-- 192
            |::|...:|..|                 |..:.|...|.: ..|||...:.||.:..|.|:|  
Human   475 VKNGQAPETCPFFEEMDALVSVRVAAPPNDGQEETASCPVQGTSEAEAQKQAEEADEATEEDSDD 539

  Fly   193 ----------------PEIAQEKGSTGTDVATEEPPEEEIAEDI------LDSDEDYDPTH---A 232
                            |.:.|...........|:..:.:|:|::      |...|...|.:   .
Human   540 DEEDTEIPPGAVITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQG 604

  Fly   233 KPEKCD-RSGR---------------------------------KPVAYHKNSPKVETFKKKVGR 263
            |..:.| ||||                                 :|..|.|       :.|..| 
Human   605 KGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQRPCLGERPYKYLK-------YSKSFG- 661

  Fly   264 KPRNKL---------STYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHM 319
             |.:.|         :.|.|..||..:...|||..|.:.|:|.||::|..||:.|..:...:.|.
Human   662 -PNSLLMHQVSHQVENPYKCADCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDSSNFITHR 725

  Fly   320 NTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPH 384
            ..|||.:||:|..|...|...|:...|.|.||.|:||.|:.|.::|..|.:...|:.|||||:||
Human   726 RIHTGEKPYQCGECGKCFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIHTGERPH 790

  Fly   385 VCDLCGKGFVKAYKLRLHRETH 406
            ||..|||.|.|:..||.|..||
Human   791 VCPDCGKSFSKSSDLRAHHRTH 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 59/152 (39%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 10/23 (43%)
C2H2 Zn finger 302..322 CDD:275368 5/19 (26%)
zf-H2C2_2 315..338 CDD:290200 8/22 (36%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 10/21 (48%)
C2H2 Zn finger 358..378 CDD:275368 5/19 (26%)
zf-H2C2_2 370..394 CDD:290200 13/23 (57%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
ZSCAN29NP_001359009.1 SCAN 14..124 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..182
Myb_DNA-bind_4 245..330 CDD:372747
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..400
Myb_DNA-bind_4 408..493 CDD:372747 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..557 11/54 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..625 6/21 (29%)
COG5048 <630..838 CDD:227381 64/192 (33%)
C2H2 Zn finger 680..700 CDD:275368 7/19 (37%)
C2H2 Zn finger 708..728 CDD:275368 5/19 (26%)
C2H2 Zn finger 736..756 CDD:275368 6/19 (32%)
C2H2 Zn finger 764..784 CDD:275368 5/19 (26%)
C2H2 Zn finger 792..812 CDD:275368 9/19 (47%)
C2H2 Zn finger 820..840 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.