Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787068.3 | Gene: | ZNF792 / 126375 | HGNCID: | 24751 | Length: | 632 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 68/202 - (33%) |
---|---|---|---|
Similarity: | 98/202 - (48%) | Gaps: | 31/202 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 THAKPEKCDRSG-----RKPVAYHK--------------------NSPKVETFKKKVGRKPRNKL 269
Fly 270 STYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCP 334
Fly 335 AAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKL 399
Fly 400 RLHRETH 406 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
COG5048 | <264..411 | CDD:227381 | 57/143 (40%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 287..311 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 315..338 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 330..350 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 370..394 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 8/19 (42%) | ||
ZNF792 | NP_787068.3 | KRAB | 14..74 | CDD:214630 | |
KRAB | 14..53 | CDD:279668 | |||
C2H2 Zn finger | 256..276 | CDD:275368 | |||
C2H2 Zn finger | 284..304 | CDD:275368 | |||
C2H2 Zn finger | 312..332 | CDD:275368 | |||
zf-H2C2_2 | 324..349 | CDD:290200 | |||
C2H2 Zn finger | 340..360 | CDD:275368 | |||
COG5048 | <348..592 | CDD:227381 | 68/202 (34%) | ||
zf-H2C2_2 | 352..377 | CDD:290200 | 5/15 (33%) | ||
C2H2 Zn finger | 368..388 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 396..416 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 424..444 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 452..472 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 464..489 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 480..500 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 492..517 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 508..528 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 520..545 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 536..556 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 548..573 | CDD:290200 | 4/9 (44%) | ||
C2H2 Zn finger | 564..584 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |