DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZNF816

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001026835.1 Gene:ZNF816 / 125893 HGNCID:26995 Length:651 Species:Homo sapiens


Alignment Length:441 Identity:104/441 - (23%)
Similarity:165/441 - (37%) Gaps:144/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MLDREASNAN-------AAGEGDLLSIAEDLSVESVLKSW----------------EDYASQ--L 127
            ||..||:..:       |..:|.|  ...|:::|..|:.|                |:|.:.  :
Human     1 MLREEATKKSKEKEPGMALPQGRL--TFRDVAIEFSLEEWKCLNPAQRALYRAVMLENYRNLEFV 63

  Fly   128 DGGMKVEGE-EDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELLTNEN 191
            |..:|...| ...:|.:...|:..|.........:.|...|   |:::...:.|::..|:..|.:
Human    64 DSSLKSMMEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFP---EMKKDIHHFEFQWQEVERNGH 125

  Fly   192 SPEIAQEKGSTGTDVATEEPPEEEIAEDILDSDEDYDPTHAKPEKCDRSGRKPV------AYHKN 250
            ...:.:.|..||                   |.:..|..||        |.||:      ::|.:
Human   126 EAPMTKIKKLTG-------------------STDRSDHRHA--------GNKPIKDQLGLSFHSH 163

  Fly   251 SPKVETFK----------KKVGRKPRN-------KLSTYI------------------------- 273
            .|::..|:          |.:|....:       :|.|:|                         
Human   164 LPELHMFQTKGKISNQLDKSIGASSASESQRISCRLKTHISNKYGKNFLHSSFTQIQEICMREKP 228

  Fly   274 ------------------------------CDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRG 308
                                          |||||.|:..:..:..|.:.|:|.|.::|..||:.
Human   229 CQSNECGKAFNYSSLLRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKT 293

  Fly   309 FVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKF 373
            |.|...||.|...|||.:|||||.|...|:::|:...|.|:||.|:||.|:.|.:||..:..|..
Human   294 FTQMSSLVCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVI 358

  Fly   374 HKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAED 424
            ||.|||||||:.|:.|||.|.:...|:.|...|.        .|:..|.|:
Human   359 HKAIHTGEKPYKCNECGKTFSQKSSLQCHHILHT--------GEKPYKCEE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 61/208 (29%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 12/22 (55%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
zf-H2C2_2 345..367 CDD:290200 11/21 (52%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 14/23 (61%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZNF816NP_001026835.1 KRAB 24..64 CDD:307490 7/41 (17%)
C2H2 Zn finger 232..251 CDD:275368 0/18 (0%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
COG5048 283..650 CDD:227381 52/127 (41%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
C2H2 Zn finger 315..335 CDD:275368 7/19 (37%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 399..419 CDD:275368 1/3 (33%)
C2H2 Zn finger 427..447 CDD:275368
C2H2 Zn finger 455..475 CDD:275368
C2H2 Zn finger 483..503 CDD:275368
C2H2 Zn finger 511..531 CDD:275368
C2H2 Zn finger 539..559 CDD:275368
C2H2 Zn finger 567..587 CDD:275368
C2H2 Zn finger 595..615 CDD:275368
C2H2 Zn finger 623..643 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.