| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016881603.1 | Gene: | ZNF730 / 100129543 | HGNCID: | 32470 | Length: | 514 | Species: | Homo sapiens |
| Alignment Length: | 201 | Identity: | 74/201 - (36%) |
|---|---|---|---|
| Similarity: | 98/201 - (48%) | Gaps: | 30/201 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 230 THAKPEKCDRSGR-----KPVAYHK-------------------NSPKVETFKKKVGRKPRNKLS 270
Fly 271 TYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPA 335
Fly 336 AFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLR 400
Fly 401 LHRETH 406 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 62/143 (43%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 7/19 (37%) | ||
| ZNF730 | XP_016881603.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||