DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trem and ZSCAN30

DIOPT Version :9

Sequence 1:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:417 Identity:101/417 - (24%)
Similarity:167/417 - (40%) Gaps:111/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LTCQ------RSHQHIMDMLDREASNANAAGEGDLLSIAEDLSVESVLKSW---------EDYAS 125
            |.||      .|.:.|:::|..|          ..|:|     :...|::|         |:..:
Human    72 LCCQWLRPEVHSKEQILELLMLE----------QFLAI-----LPEELQAWLREHRPENGEEAVT 121

  Fly   126 QLDGGMKVEGEEDQQ----HQVITYVVEDGDTDDTNMFDVHDPTQPVPN----EIEEAETYAEYE 182
            .|: .::.|.||.:|    |....:..|...|.......::.|.||:.|    |.:|::.:.|.:
Human   122 MLE-ELEKELEEPRQQDTTHGQEMFWQEMTSTGALKSLSLNSPVQPLENQCKTETQESQAFQERD 185

  Fly   183 -----------EYELLT---------------NENSPEIAQE-----------KGSTGTDVATEE 210
                       :.|::.               ..:|..||:|           ||:...:..::.
Human   186 GRMVAGKVLMAKQEIVECVASAAMISPGKLPGETHSQRIAEEALGGLDNSKKQKGNAAGNKISQL 250

  Fly   211 PPEEE------------IAEDILDSDEDYD--------------PTHAKPEKCDRSGRKPVAYHK 249
            |.::.            ....:|:|.|...              .|..|..:|...|:   |:.:
Human   251 PSQDRHFSLATFNRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREKLYECFDCGK---AFCQ 312

  Fly   250 NSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQ 314
            :|..:...:...|.:|      |.|..||..:...:.|..|.:.|||.||:||..||:.|..:.:
Human   313 SSKLIRHQRIHTGERP------YACKECGKAFSLSSDLVRHQRIHSGEKPYECCECGKAFRGSSE 371

  Fly   315 LVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFTYSDNLKFHKMIHT 379
            |:||...|||.:||:|..|..||:..|...:|.:|||.::.|.|..|.:.|..|..|..|:.|||
Human   372 LIRHRRIHTGEKPYECGECGKAFSRSSALIQHKKIHTGDKSYECIACGKAFGRSSILIEHQRIHT 436

  Fly   380 GEKPHVCDLCGKGFVKAYKLRLHRETH 406
            ||||:.|:.|||.|.::..|..|:..|
Human   437 GEKPYECNECGKSFNQSSALTQHQRIH 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tremNP_650861.1 zf-AD 11..87 CDD:214871 5/16 (31%)
COG5048 <264..411 CDD:227381 56/143 (39%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
zf-H2C2_2 287..311 CDD:290200 12/23 (52%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 11/22 (50%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 345..367 CDD:290200 8/21 (38%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 13/23 (57%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708 20/97 (21%)
SCAN 44..122 CDD:280241 12/64 (19%)
COG5048 281..>360 CDD:227381 20/87 (23%)
zf-C2H2 301..323 CDD:278523 4/24 (17%)
C2H2 Zn finger 303..323 CDD:275368 4/22 (18%)
zf-H2C2_2 316..339 CDD:290200 6/28 (21%)
COG5048 <328..479 CDD:227381 56/142 (39%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
zf-H2C2_2 343..366 CDD:290200 11/22 (50%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
zf-H2C2_2 371..396 CDD:290200 12/24 (50%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..424 CDD:290200 8/24 (33%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..452 CDD:290200 14/23 (61%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..480 CDD:290200 3/9 (33%)
C2H2 Zn finger 471..491 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.