| Sequence 1: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001120661.1 | Gene: | Zfp984 / 100041677 | MGIID: | 3651978 | Length: | 547 | Species: | Mus musculus |
| Alignment Length: | 214 | Identity: | 68/214 - (31%) |
|---|---|---|---|
| Similarity: | 97/214 - (45%) | Gaps: | 38/214 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 230 THAKPEKCDR-----SGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTE 289
Fly 290 HMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKHHRIHTKER 354
Fly 355 PYVCDVCSRTFTYSDNLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEES 419
Fly 420 TKAEDVKGETPEFLNELPK 438 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 55/146 (38%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 6/19 (32%) | ||
| Zfp984 | NP_001120661.1 | KRAB | 12..52 | CDD:396083 | |
| C2H2 Zn finger | 184..204 | CDD:275368 | |||
| C2H2 Zn finger | 216..232 | CDD:275368 | |||
| COG5048 | <220..465 | CDD:227381 | 66/208 (32%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | |||
| C2H2 Zn finger | 268..288 | CDD:275368 | |||
| C2H2 Zn finger | 296..316 | CDD:275368 | 2/22 (9%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 352..372 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 380..400 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 408..428 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 436..456 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 464..484 | CDD:275368 | 2/6 (33%) | ||
| zf-H2C2_2 | 476..500 | CDD:404364 | |||
| C2H2 Zn finger | 492..512 | CDD:275368 | |||
| zf-H2C2_2 | 504..529 | CDD:404364 | |||
| C2H2 Zn finger | 520..540 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||