DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF623

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_055604.3 Gene:ZNF623 / 9831 HGNCID:29084 Length:536 Species:Homo sapiens


Alignment Length:139 Identity:54/139 - (38%)
Similarity:78/139 - (56%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDY 238
            :...:.|..|...:..|..|..|.::|:.::|.||..|.|.|.::.:|.:|...|||.|||.|:.
Human   287 EVKQYECKECGKAFRHRSDLIEHQRIHTGERPFECNECGKAFIRSSKLIQHQRIHTGERPYVCNE 351

  Fly   239 CDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLH 303
            |..||:..|...:||||||.|:.|:|..|.::|..|:.|..|.|.|||||.:.|:.|.|:|.|..
Human   352 CGKRFSQTSNFTQHQRIHTGEKLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKA 416

  Fly   304 HKNSHEKSH 312
            |...|:|.|
Human   417 HLTEHQKIH 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 9/23 (39%)
COG5048 201..>258 CDD:227381 24/56 (43%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 11/21 (52%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
ZNF623NP_055604.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..77
COG5048 123..494 CDD:227381 54/139 (39%)
C2H2 Zn finger 125..145 CDD:275368
C2H2 Zn finger 153..173 CDD:275368
C2H2 Zn finger 181..201 CDD:275368
C2H2 Zn finger 209..229 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
C2H2 Zn finger 265..285 CDD:275368
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
C2H2 Zn finger 321..341 CDD:275368 6/19 (32%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
C2H2 Zn finger 405..425 CDD:275368 8/19 (42%)
C2H2 Zn finger 433..453 CDD:275368
C2H2 Zn finger 461..481 CDD:275368
C2H2 Zn finger 489..509 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.