Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_219363.2 | Gene: | ZNF764 / 92595 | HGNCID: | 28200 | Length: | 408 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 69/258 - (26%) |
---|---|---|---|
Similarity: | 104/258 - (40%) | Gaps: | 52/258 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 DEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESV 157
Fly 158 YSLSP------------KPVTFEDEDSG----------------------QAASFTCNICNNVYS 188
Fly 189 ERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQ 253
Fly 254 RIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTK 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
C2H2 Zn finger | 180..200 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 8/23 (35%) | ||
COG5048 | 201..>258 | CDD:227381 | 21/56 (38%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 9/21 (43%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 5/19 (26%) | ||
ZNF764 | NP_219363.2 | zf-H2C2_2 | 301..326 | CDD:290200 | 12/24 (50%) |
C2H2 Zn finger | 317..337 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 333..352 | CDD:290200 | 3/9 (33%) | ||
C2H2 Zn finger | 345..365 | CDD:275368 | |||
KRAB | 26..85 | CDD:214630 | |||
KRAB | 26..65 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..167 | 15/82 (18%) | |||
C2H2 Zn finger | 177..197 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 190..212 | CDD:290200 | 3/21 (14%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 217..242 | CDD:290200 | 8/24 (33%) | ||
COG5048 | 229..>294 | CDD:227381 | 25/64 (39%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 245..270 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 261..281 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 273..298 | CDD:290200 | 9/24 (38%) | ||
COG5048 | 285..>350 | CDD:227381 | 22/57 (39%) | ||
C2H2 Zn finger | 289..309 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |