DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and ZNF766

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	XP_011525762.1	Gene:	ZNF766 / 90321	HGNCID:	28063	Length:	483	Species:	Homo sapiens

Alignment Length:	142	Identity:	56/142 - (39%)
Similarity:	80/142 - (56%)	Gaps:	0/142 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242
            :.||.|..|:|....|..|.|:|:.:|||:|..|.|.:..:..||:|...|||.:.|||:.|...
Human   286 YKCNECGKVFSRITYLVRHQKIHTREKPHKCNKCGKVYSSSSYLAQHWRIHTGEKLYKCNKCGKE 350

  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNS 307
            |:..|:...|..|||.|:||||:.|.::|.:...|.||.:.|.||:|:.|..|.|.|:|:.|...
Human   351 FSGHSSLTTHLLIHTGEKPYKCKECDKAFRHKFSLTVHQRNHNGEKPYKCHECGKVFTQVSHLAR 415

  Fly   308 HEKSHKRTKEVK 319
            |:|.|...|..|
Human   416 HQKIHTGEKPYK 427

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368	8/19 (42%)
		zf-H2C2_2	193..217	CDD:290200	10/23 (43%)
		COG5048	201..>258	CDD:227381	21/56 (38%)
		C2H2 Zn finger	208..228	CDD:275368	6/19 (32%)
		zf-H2C2_2	221..244	CDD:290200	10/22 (45%)
		C2H2 Zn finger	236..256	CDD:275368	5/19 (26%)
		zf-H2C2_2	251..273	CDD:290200	11/21 (52%)
		C2H2 Zn finger	264..284	CDD:275368	6/19 (32%)
		zf-H2C2_2	277..301	CDD:290200	11/23 (48%)
		C2H2 Zn finger	292..312	CDD:275368	8/19 (42%)
ZNF766	XP_011525762.1	KRAB	24..84	CDD:214630
		KRAB	24..63	CDD:279668
		C2H2 Zn finger	204..224	CDD:275368
		C2H2 Zn finger	232..252	CDD:275368
		C2H2 Zn finger	260..280	CDD:275368
		zf-H2C2_2	272..297	CDD:290200	4/10 (40%)
		C2H2 Zn finger	288..308	CDD:275368	8/19 (42%)
		zf-H2C2_2	300..325	CDD:290200	10/24 (42%)
		COG5048	<312..472	CDD:227381	47/116 (41%)
		C2H2 Zn finger	316..336	CDD:275368	6/19 (32%)
		C2H2 Zn finger	344..364	CDD:275368	5/19 (26%)
		zf-H2C2_2	356..381	CDD:290200	11/24 (46%)
		C2H2 Zn finger	372..392	CDD:275368	6/19 (32%)
		zf-H2C2_2	384..409	CDD:290200	11/24 (46%)
		C2H2 Zn finger	400..420	CDD:275368	8/19 (42%)
		zf-H2C2_2	412..437	CDD:290200	6/16 (38%)
		C2H2 Zn finger	428..448	CDD:275368	56/142 (39%)
		zf-H2C2_2	440..465	CDD:290200
		C2H2 Zn finger	456..474	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000