DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and ZNF527

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	NP_115829.1	Gene:	ZNF527 / 84503	HGNCID:	29385	Length:	609	Species:	Homo sapiens

Alignment Length:	173	Identity:	64/173 - (36%)
Similarity:	89/173 - (51%)	Gaps:	34/173 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242
            |.||.|...:|....|..|.::|:.:||:||:.|:|.|||:..|.:|...|||.:||:|:.|...
Human   358 FACNECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCGKA 422

  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVL----RVHL---------------------- 281
            |:.......||||||.|:|:||..|.::|||.:.|    |:|.
Human   423 FSRRIALTLHQRIHTGEKPFKCSECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRTDSQLNR 487

  Fly   282 --KTHTGERPFSCQYCQKSFSQ----LHHKNSH--EKSHKRTK 316
              :.|||||||.|..|.|:||.    :|||.||  ||.::..|
Human   488 HHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNK 530

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368	6/19 (32%)
		zf-H2C2_2	193..217	CDD:290200	10/23 (43%)
		COG5048	201..>258	CDD:227381	24/56 (43%)
		C2H2 Zn finger	208..228	CDD:275368	8/19 (42%)
		zf-H2C2_2	221..244	CDD:290200	9/22 (41%)
		C2H2 Zn finger	236..256	CDD:275368	6/19 (32%)
		zf-H2C2_2	251..273	CDD:290200	12/21 (57%)
		C2H2 Zn finger	264..284	CDD:275368	8/47 (17%)
		zf-H2C2_2	277..301	CDD:290200	14/51 (27%)
		C2H2 Zn finger	292..312	CDD:275368	12/25 (48%)
ZNF527	NP_115829.1	KRAB	14..53	CDD:279668
		C2H2 Zn finger	222..240	CDD:275368
		C2H2 Zn finger	252..268	CDD:275368
		C2H2 Zn finger	277..296	CDD:275368
		C2H2 Zn finger	304..324	CDD:275368
		zf-H2C2_2	317..341	CDD:290200
		COG5048	<328..490	CDD:227381	44/131 (34%)
		C2H2 Zn finger	332..352	CDD:275368
		zf-H2C2_2	344..369	CDD:290200	4/10 (40%)
		C2H2 Zn finger	360..380	CDD:275368	6/19 (32%)
		zf-H2C2_2	373..397	CDD:290200	10/23 (43%)
		C2H2 Zn finger	388..408	CDD:275368	8/19 (42%)
		zf-H2C2_2	400..425	CDD:290200	10/24 (42%)
		C2H2 Zn finger	416..436	CDD:275368	6/19 (32%)
		zf-H2C2_2	428..453	CDD:290200	12/24 (50%)
		C2H2 Zn finger	444..464	CDD:275368	7/19 (37%)
		zf-H2C2_2	456..481	CDD:290200	3/24 (13%)
		C2H2 Zn finger	472..492	CDD:275368	0/19 (0%)
		zf-H2C2_2	485..508	CDD:290200	10/22 (45%)
		C2H2 Zn finger	500..520	CDD:275368	8/19 (42%)
		zf-H2C2_2	516..537	CDD:290200	7/15 (47%)
		C2H2 Zn finger	528..548	CDD:275368	1/3 (33%)
		zf-H2C2_2	540..565	CDD:290200
		C2H2 Zn finger	556..576	CDD:275368
		zf-H2C2_2	568..593	CDD:290200
		C2H2 Zn finger	584..604	CDD:275368
		KRAB	14..74	CDD:214630
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000