DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF394

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_115540.2 Gene:ZNF394 / 84124 HGNCID:18832 Length:561 Species:Homo sapiens


Alignment Length:312 Identity:85/312 - (27%)
Similarity:126/312 - (40%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LRSLCQQTEKD-LKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTL 130
            |.|.|..|.:| :::|....:.::: .:..|.:......|::||   ||   :|.|  ||.:..|
Human   231 LFSKCGSTHEDRVEKQSGDPLPLKL-ENSPEAEGLNSISDVNKN---GS---IEGE--DSKNNEL 286

  Fly   131 ESSEDVACSADELVSIEPAISAPEESV---------------YSLSPKPVTFEDEDSG------- 173
            ::|  ..||...|....|....|.:|.               :.|.|     ...|||       
Human   287 QNS--ARCSNLVLCQHIPKAERPTDSEEHGNKCKQSFHMVTWHVLKP-----HKSDSGDSFHHSS 344

  Fly   174 ---------QAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHT 229
                     :...:.|..|...:.:|..|..|.::|:.:||:.|:.|.|.|.|:..|.:|..|||
Human   345 LFETQRQLHEERPYKCGNCGKSFKQRSDLFRHQRIHTGEKPYGCQECGKSFSQSAALTKHQRTHT 409

  Fly   230 GNRPYKCDYCDSRFADP---------------------------STRIKHQRIHTNERPYKCEFC 267
            |.:||.|..|..||...                           |...:|||:|..|||||||.|
Human   410 GEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCEECGETCHISNLFRHQRLHKGERPYKCEEC 474

  Fly   268 SRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319
            .:||...:.|..|.:.||||:|:.|..|.|.|:|......|::.|...|..|
Human   475 EKSFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQRIHTGEKPYK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 9/23 (39%)
COG5048 201..>258 CDD:227381 24/83 (29%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/46 (17%)
zf-H2C2_2 251..273 CDD:290200 14/21 (67%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 11/23 (48%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
ZNF394NP_115540.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
SCAN 60..170 CDD:128708
KRAB_A-box 155..214 CDD:322003
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..285 16/62 (26%)
C2H2 Zn finger 337..353 CDD:275368 1/15 (7%)
COG5048 356..>420 CDD:227381 22/63 (35%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
zf-C2H2 414..436 CDD:306579 5/21 (24%)
C2H2 Zn finger 416..436 CDD:275368 4/19 (21%)
C2H2 Zn finger 444..463 CDD:275368 4/18 (22%)
SFP1 <464..543 CDD:227516 26/63 (41%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
C2H2 Zn finger 499..519 CDD:275368 6/19 (32%)
C2H2 Zn finger 527..547 CDD:275368 85/312 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.