DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF22

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_008894.2 Gene:ZNF22 / 7570 HGNCID:13012 Length:224 Species:Homo sapiens


Alignment Length:161 Identity:68/161 - (42%)
Similarity:85/161 - (52%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLAR 223
            ||..||             :.|..|...:|:...|..|.|:|:.||.|:|..|.|.|.|:..|.:
Human    49 SLDDKP-------------YKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQ 100

  Fly   224 HMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGER 288
            |...|||.:|||||.|...|...|..|:||||||.|:||:|:.|.|.|..|:.|..|.:|||||:
Human   101 HRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEK 165

  Fly   289 PFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319
            |:.|..|.|.|||..|...|.|.||..|..|
Human   166 PYQCSECGKCFSQSSHLRQHMKVHKEEKPRK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 27/56 (48%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
zf-H2C2_2 251..273 CDD:290200 13/21 (62%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
ZNF22NP_008894.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
COG5048 <41..194 CDD:227381 66/157 (42%)
C2H2 Zn finger 57..77 CDD:275368 6/19 (32%)
C2H2 Zn finger 85..105 CDD:275368 7/19 (37%)
C2H2 Zn finger 113..133 CDD:275368 9/19 (47%)
C2H2 Zn finger 141..161 CDD:275368 7/19 (37%)
C2H2 Zn finger 169..189 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2318
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.