DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and MYNN

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001172047.1 Gene:MYNN / 55892 HGNCID:14955 Length:610 Species:Homo sapiens


Alignment Length:351 Identity:90/351 - (25%)
Similarity:153/351 - (43%) Gaps:79/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ELSESPDW--PNRICTSCALLLR--------AALKLRSL----------CQQTEKDLKEQKLQEI 86
            |:.::.|:  ...:.|.|.:.:.        ::.::.|:          |..|.:|...::..|:
Human    94 EIHQAADYLKVEEVVTKCKIKMEDFAFIANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEV 158

  Fly    87 NIEIVH----------DEQETKKKTESRDLSKNEATGSDSELEYE-----------YLDSYDVTL 130
            :.:::.          ...:||||.::.:..|   ||.:..::|.           :||:..:..
Human   159 STDLIQANPKQGALAKKSSQTKKKKKAFNSPK---TGQNKTVQYPSDILENASVELFLDANKLPT 220

  Fly   131 ESSEDVACSAD----ELVSI-----------------------EPAISAPEESVYSLSPKPVTFE 168
            ...|.||...|    ||.|:                       :|..:..|.|:.:::.....:|
Human   221 PVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYE 285

  Fly   169 DEDSGQ-------AASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMN 226
            .|:||:       .|...||.|..|:||...|..||::|...||:.|.:|.|.|.|..||..|:.
Human   286 AENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVR 350

  Fly   227 THTGNRPYKCDYCDSRFADPSTRIKHQRI-HTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPF 290
            ||||.:||||:.||..||.....:.|.|: |..|:||||:.|:..|..|:.|::|.:.|:||:|:
Human   351 THTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPY 415

  Fly   291 SCQYCQKSFSQLHHKNSHEKSHKRTK 316
            .|..|.:.|:|......|.:.|...|
Human   416 VCDRCGQRFAQASTLTYHVRRHTGEK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 3/16 (19%)
C2H2 Zn finger 180..200 CDD:275368 9/19 (47%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 25/57 (44%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
zf-H2C2_2 221..244 CDD:290200 12/22 (55%)
C2H2 Zn finger 236..256 CDD:275368 7/20 (35%)
zf-H2C2_2 251..273 CDD:290200 10/22 (45%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 9/23 (39%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
MYNNNP_001172047.1 BTB 14..115 CDD:306997 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..197 7/30 (23%)
Nuclear localization signal. /evidence=ECO:0000255 174..190 4/15 (27%)
Nuclear localization signal. /evidence=ECO:0000255 257..262 0/4 (0%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
zf-C2H2 304..324 CDD:306579 9/19 (47%)
zf-H2C2_2 316..341 CDD:316026 10/24 (42%)
C2H2 Zn finger 332..352 CDD:275368 8/19 (42%)
zf-H2C2_2 345..369 CDD:316026 13/23 (57%)
SFP1 <354..438 CDD:227516 31/83 (37%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)
zf-H2C2_2 430..453 CDD:316026 3/12 (25%)
SFP1 <439..522 CDD:227516 1/3 (33%)
C2H2 Zn finger 445..465 CDD:275368
C2H2 Zn finger 473..493 CDD:275368
C2H2 Zn finger 501..522 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.