DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and jim

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	NP_001262221.1	Gene:	jim / 43924	FlyBaseID:	FBgn0027339	Length:	938	Species:	Drosophila melanogaster

Alignment Length:	142	Identity:	49/142 - (34%)
Similarity:	72/142 - (50%)	Gaps:	2/142 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   180 CNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFA 244
            |.||:..:.::..|..|..:|...:|:.|..|.|||||...|.:|:..||..:|:.|.||...|.
  Fly   527 CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFR 591

  Fly   245 DPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQY--CQKSFSQLHHKNS 307
            ..:...:|.||||.|:||||..|.:.|....:|..|.:||.|:|||.|..  |::.|:..:....
  Fly   592 QRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTK 656

  Fly   308 HEKSHKRTKEVK 319
            |..:|......|
  Fly   657 HIDNHMNPNTTK 668

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368	5/19 (26%)
		zf-H2C2_2	193..217	CDD:290200	9/23 (39%)
		COG5048	201..>258	CDD:227381	21/56 (38%)
		C2H2 Zn finger	208..228	CDD:275368	9/19 (47%)
		zf-H2C2_2	221..244	CDD:290200	8/22 (36%)
		C2H2 Zn finger	236..256	CDD:275368	6/19 (32%)
		zf-H2C2_2	251..273	CDD:290200	12/21 (57%)
		C2H2 Zn finger	264..284	CDD:275368	5/19 (26%)
		zf-H2C2_2	277..301	CDD:290200	11/25 (44%)
		C2H2 Zn finger	292..312	CDD:275368	4/21 (19%)
jim	NP_001262221.1	C2H2 Zn finger	331..351	CDD:275368
		COG5048	355..666	CDD:227381	48/138 (35%)
		zf-C2H2	357..379	CDD:278523
		C2H2 Zn finger	359..379	CDD:275368
		zf-H2C2_2	371..396	CDD:290200
		C2H2 Zn finger	387..407	CDD:275368
		zf-H2C2_2	400..424	CDD:290200
		C2H2 Zn finger	415..435	CDD:275368
		C2H2 Zn finger	527..547	CDD:275368	5/19 (26%)
		zf-C2H2	553..575	CDD:278523	9/21 (43%)
		C2H2 Zn finger	555..575	CDD:275368	9/19 (47%)
		C2H2 Zn finger	583..603	CDD:275368	6/19 (32%)
		zf-H2C2_2	596..620	CDD:290200	12/23 (52%)
		C2H2 Zn finger	611..631	CDD:275368	5/19 (26%)
		zf-H2C2_2	624..650	CDD:290200	11/25 (44%)
		C2H2 Zn finger	639..661	CDD:275368	4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45471452
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930