DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and gl

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster


Alignment Length:167 Identity:61/167 - (36%)
Similarity:88/167 - (52%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SLSPKPVTFEDED-------------SGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEI 210
            |||    .||||:             .|:.....|.:|...|:....|..|::.||.::|:.|..
  Fly   409 SLS----AFEDEEDSNEDLDGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPD 469

  Fly   211 CHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSN 275
            |:|.|.|...|..|:.||||.:|::|..||.||:..|:...|.|.|:.||||:|..|.:||..|:
  Fly   470 CNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSS 534

  Fly   276 VLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSH 312
            .|..||:.|:||:|:.|:.|...|||..:.|.|.:.|
  Fly   535 TLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 9/23 (39%)
COG5048 201..>258 CDD:227381 23/56 (41%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 11/21 (52%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 5/19 (26%)
zf-C2H2 439..459 CDD:278523 5/19 (26%)
zf-H2C2_2 452..476 CDD:290200 9/23 (39%)
C2H2 Zn finger 467..487 CDD:275368 7/19 (37%)
zf-H2C2_2 479..504 CDD:290200 12/24 (50%)
zf-C2H2_8 492..570 CDD:292531 33/77 (43%)
C2H2 Zn finger 495..515 CDD:275368 8/19 (42%)
zf-H2C2_2 507..531 CDD:290200 10/23 (43%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 536..560 CDD:290200 10/23 (43%)
C2H2 Zn finger 551..571 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.