DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and CG31388

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:402 Identity:91/402 - (22%)
Similarity:146/402 - (36%) Gaps:104/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRIC-----------LVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAAL 65
            ||.|           |..|...|::       .:|:..|.::|.|....|..:|..|...|:.|:
  Fly     5 CRTCSRMADPAVAKNLFDPSSSSVL-------RQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAI 62

  Fly    66 KLRSLC-----------QQTEKD------LKEQKLQEINIEI--------VHDEQETKKKTESRD 105
            ..|.:|           :|.||:      |.||.|.:...|:        ::|..:.....|.:|
  Fly    63 DFRRVCIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQD 127

  Fly   106 LSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADELVS-------IEPAISAPE--------- 154
            .:.:|.....:....||:::|............|.|..:|       :.|. |.||         
  Fly   128 KNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPE-SEPESEAIDNRDT 191

  Fly   155 ESVYSLSPKPVTFEDEDSGQA-----------ASFTCNICNNVYSERVKLTNHMKV------HSA 202
            .|.::.|...:.||:.|..:.           ..|.|:.|:..:.....||.|..:      ||.
  Fly   192 SSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHCNMINLPLTHSC 256

  Fly   203 KK------------------------PHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRF 243
            .|                        .|.|.||.|.......|..|:..|.|.|.:|||.|.:.|
  Fly   257 TKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASF 321

  Fly   244 ADPSTRIKHQRIHTNERPYKCEF-CSRSFGYSNVLRVHLKTH--TGERPFSCQYCQKSFSQLHHK 305
            ...:....||:.||.||||.|.: |.::|.:.:...:|.:.|  ..:|.:.|:||.||:......
  Fly   322 YTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSEC 386

  Fly   306 NSHEKSHKRTKE 317
            .:|:|.|..|::
  Fly   387 RTHQKYHNLTRD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 12/55 (22%)
C2H2 Zn finger 180..200 CDD:275368 5/25 (20%)
zf-H2C2_2 193..217 CDD:290200 11/53 (21%)
COG5048 201..>258 CDD:227381 20/80 (25%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 9/22 (41%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 11/22 (50%)
C2H2 Zn finger 264..284 CDD:275368 4/20 (20%)
zf-H2C2_2 277..301 CDD:290200 8/25 (32%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 17/77 (22%)
C2H2 Zn finger 228..254 CDD:275368 5/25 (20%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..363 CDD:275368 4/20 (20%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..419 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.