DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and CG14667

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:340 Identity:85/340 - (25%)
Similarity:139/340 - (40%) Gaps:62/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRIC----LVQPKDESL-MPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLRSLC 71
            ||||    :...:|.:: :.....:..::|..|||||:.:...|..:|..|...|..|.|.|..|
  Fly     7 CRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKFRERC 71

  Fly    72 QQTEKDLKEQKLQEINIEIVHDEQETKKKTESR-----DLSK---NEATGSDSELEYEYLDS--- 125
            ..::|.|         ::|:       |||..:     :||.   :|......:||..|.|.   
  Fly    72 IFSQKYL---------LDII-------KKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYV 120

  Fly   126 -YDVTLESSEDVA-------CSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAAS----- 177
             |..|.|..:|:.       .||..:.:.|.|..|.::.         ..::::..:||.     
  Fly   121 CYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEAAQQE---------DLQEQEMERAAKRRSNF 176

  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKP----HECEICHKRFRQTPQLARH-MNTHTGNRPYKCD 237
            |.|:.|..::.:....|.|:..|..::.    ..|..|.:.|.:...|.:| ...|..||.::|.
  Fly   177 FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCT 241

  Fly   238 YCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGE-RPFSCQYCQKSFSQ 301
            .|...||....:::|.:.|.|||||.|..|...|...:.|:.|..||:.: |.|.|:.|...|..
  Fly   242 ICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306

  Fly   302 LHHKNSHEKS--HKR 314
            .....:|.|:  |||
  Fly   307 RRGLVAHTKTAPHKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 13/49 (27%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
zf-H2C2_2 193..217 CDD:290200 6/27 (22%)
COG5048 201..>258 CDD:227381 14/61 (23%)
C2H2 Zn finger 208..228 CDD:275368 5/20 (25%)
zf-H2C2_2 221..244 CDD:290200 7/23 (30%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-H2C2_2 277..301 CDD:290200 9/24 (38%)
C2H2 Zn finger 292..312 CDD:275368 5/21 (24%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 21/81 (26%)
C2H2 Zn finger 179..199 CDD:275368 4/19 (21%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 22/69 (32%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.