DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and Kr

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:194 Identity:67/194 - (34%)
Similarity:95/194 - (48%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 VTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAA------------SFTC 180
            |..|...:::.|.:::........:|..|    ...|.:..|...|.|.            ||||
  Fly   164 VKKEFQTEISMSVNDMYHTSGGPISPPSS----GSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTC 224

  Fly   181 NICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFAD 245
            .||:..:..:..|.||.:.|:.:||.||..|||||.:...|..||..|||.:||.|.:||.:|..
  Fly   225 KICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQ 289

  Fly   246 PSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHE 309
            .:...:|.|:||.||||.||.|...|..||.|:.|:..|.||:||.|:.|...|.:.||..:|:
  Fly   290 VANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
zf-H2C2_2 193..217 CDD:290200 13/23 (57%)
COG5048 201..>258 CDD:227381 24/56 (43%)
C2H2 Zn finger 208..228 CDD:275368 9/19 (47%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 12/21 (57%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 6/18 (33%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
zf-H2C2_2 237..261 CDD:290200 13/23 (57%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 12/24 (50%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 11/23 (48%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 10/23 (43%)
C2H2 Zn finger 336..352 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.