DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and cg

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster


Alignment Length:190 Identity:62/190 - (32%)
Similarity:92/190 - (48%) Gaps:15/190 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LESSEDVACSADELVSIEPAISAPEESVYSLSPK-----PVTFEDEDS--GQAASFTCNICNNVY 187
            ||.:||....|..| .:||       ....||||     .:.|.:.|:  .:...::|:.|...:
  Fly   245 LEDNEDSQGEAPNL-KLEP-------GTLELSPKTELQESMHFSETDATIKKERPYSCDECGKSF 301

  Fly   188 SERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKH 252
            ..:..||.|.:||:.::||.|..|.|.|.....|..|:..|:..|||:|..|...|......:.|
  Fly   302 LLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTH 366

  Fly   253 QRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSH 312
            .|:|:.|||:.|:.|.|:|.....|..|.|.|.||||:.|:.|.:||:|.:|...|.:.|
  Fly   367 SRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 18/56 (32%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 8/22 (36%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
cgNP_001097306.2 COG5048 287..>371 CDD:227381 24/83 (29%)
C2H2 Zn finger 294..314 CDD:275368 5/19 (26%)
zf-H2C2_2 306..331 CDD:290200 11/24 (46%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
zf-H2C2_2 362..385 CDD:290200 9/22 (41%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 12/24 (50%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
SIR2 <425..>465 CDD:294129 1/2 (50%)
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.