DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF233

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_024307256.1 Gene:ZNF233 / 353355 HGNCID:30946 Length:727 Species:Homo sapiens


Alignment Length:142 Identity:61/142 - (42%)
Similarity:83/142 - (58%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242
            :.|:.|...:|:...|..|.:||..:||::||.|.|.|.|:..|..|...|||..|||||.|...
Human   565 YKCDTCGKDFSQISHLQAHQRVHKGEKPYKCETCGKGFSQSSHLQDHQQVHTGENPYKCDVCGKG 629

  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNS 307
            |:..|....|||:||.|:|||||.|.:.|.:::.|.||.:.||||:|:.|..|.|||||..|..:
Human   630 FSWSSHLQAHQRVHTGEKPYKCEECRKGFIWNSYLHVHQRIHTGEKPYKCGMCGKSFSQTSHLQA 694

  Fly   308 HEKSHKRTKEVK 319
            |::.|...|..|
Human   695 HQRVHTGEKPYK 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 25/56 (45%)
C2H2 Zn finger 208..228 CDD:275368 8/19 (42%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 13/21 (62%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 13/23 (57%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
ZNF233XP_024307256.1 KRAB 65..123 CDD:214630
C2H2 Zn finger 321..337 CDD:275368
C2H2 Zn finger 345..365 CDD:275368
C2H2 Zn finger 377..393 CDD:275368
C2H2 Zn finger 401..421 CDD:275368
C2H2 Zn finger 429..449 CDD:275368
COG5048 <507..656 CDD:227381 40/90 (44%)
C2H2 Zn finger 511..531 CDD:275368
C2H2 Zn finger 539..559 CDD:275368
C2H2 Zn finger 567..587 CDD:275368 5/19 (26%)
C2H2 Zn finger 595..615 CDD:275368 8/19 (42%)
C2H2 Zn finger 623..643 CDD:275368 8/19 (42%)
C2H2 Zn finger 651..671 CDD:275368 7/19 (37%)
zf-C2H2 677..699 CDD:306579 9/21 (43%)
C2H2 Zn finger 679..699 CDD:275368 9/19 (47%)
zf-H2C2_2 691..714 CDD:316026 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.