DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and CG17568

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:295 Identity:79/295 - (26%)
Similarity:123/295 - (41%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADE 142
            |.|:...::::|.|.||...::.::.|..|.......:::::.|.|||    .|..:|......:
  Fly   188 LLEKNTSQLDMEDVLDELPQEELSQPRLDSTTSPASMENDVKSEMLDS----CEGDDDFLPVDGQ 248

  Fly   143 LVSIEPAISAPE--ESVYSLSPKPVTFEDEDSGQA----ASF----------------------T 179
            |:.:....:.|.  ||......|....:.|..|:.    ||:                      |
  Fly   249 LMDLVAVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTT 313

  Fly   180 CNICNNVYSERVKLTNHMK-VHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRF 243
            |:|||...|....|..|.: :|...||:.|:.|.|:.:....|..|...||.:||::|..|.:.|
  Fly   314 CDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGF 378

  Fly   244 -------------ADPS--------------TRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHL 281
                         |:||              |...|:.:||.||..||:.|...|..|..|:.||
  Fly   379 KNRARLKAHYQIHAEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHL 443

  Fly   282 KTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTK 316
            .:|||.||:.|.||.|||:    .|::.:|||..|
  Fly   444 LSHTGLRPYVCNYCGKSFA----CNANCRSHKLKK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
zf-H2C2_2 193..217 CDD:290200 8/24 (33%)
COG5048 201..>258 CDD:227381 20/83 (24%)
C2H2 Zn finger 208..228 CDD:275368 5/19 (26%)
zf-H2C2_2 221..244 CDD:290200 9/35 (26%)
C2H2 Zn finger 236..256 CDD:275368 8/46 (17%)
zf-H2C2_2 251..273 CDD:290200 9/21 (43%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-H2C2_2 277..301 CDD:290200 14/23 (61%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 53/161 (33%)
C2H2 Zn finger 314..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 3/19 (16%)
C2H2 Zn finger 398..418 CDD:275368 2/19 (11%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 439..463 CDD:290200 14/27 (52%)
C2H2 Zn finger 454..475 CDD:275368 11/25 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.