DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and CG17328

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:134/318 - (42%) Gaps:61/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRICL--------VQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLR 68
            ||:||        :...|.::||:.     .:.:|..:.:.::...|:.||.:|...|..|...:
  Fly     9 CRVCLEELHPVTSIYSTDFAMMPSV-----MLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFK 68

  Fly    69 SLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESS 133
            ..|:.::..|::.      :.|:...::            :.||.:|. :|...|...|      
  Fly    69 QECENSDLRLRQY------LGILESWRQ------------DAATNTDF-VEKPLLPQRD------ 108

  Fly   134 EDVACSADELVSIEPAIS--------APEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSER 190
                  :||...::..:|        .|.|......||||        .....||..|:..:...
  Fly   109 ------SDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPV--------PKMPHTCYECHKSFKCI 159

  Fly   191 VKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRI 255
            .:||.|::.|:.:||::|..|.:||.|...|..|..||||::|::|:.|..:|:.......||:|
  Fly   160 AQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKI 224

  Fly   256 HTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHE-KSH 312
            |...|...|..|.:.|..:..|..|:.||||.:...|..|.|:||:.....:|: |.|
  Fly   225 HLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 11/52 (21%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 21/56 (38%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 9/22 (41%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 8/21 (38%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 16/75 (21%)
COG5048 146..>211 CDD:227381 23/64 (36%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 9/23 (39%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.