DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and CG42726

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:325 Identity:70/325 - (21%)
Similarity:118/325 - (36%) Gaps:95/325 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRI--------------CTSCALLL 61
            |||:|||....:.|         :.:....|::.|:.:...|.              ||.|    
  Fly    26 KCRLCLVADVSDCL---------ECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTVC---- 77

  Fly    62 RAALKLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSY 126
                         .||.:.:..|..::...:|   ..||...::..:..||  .|.|:|..:   
  Fly    78 -------------NKDFRSRTQQYYHLTCGND---LLKKFNCKECGRRFAT--SSHLKYHLM--- 121

  Fly   127 DVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERV 191
                                    |..::|.:|                    |::|:..:.:.:
  Fly   122 ------------------------SHEKQSKHS--------------------CSVCHKSFKQPI 142

  Fly   192 KLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTG-NRPYKCDYCDSRFADPSTRIKHQRI 255
            .|..||..|:.:| |.|.||.|.||:...||.|:..|:. ...:||:.|...|.:.:...:|.|.
  Fly   143 VLQRHMLTHNQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRK 206

  Fly   256 H-TNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319
            | .|...:.|:.|.:||.....||:|:|.|:.....||..|.||::.......|.:.||..:..:
  Fly   207 HDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYR 271

  Fly   320  319
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 11/58 (19%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 19/58 (33%)
C2H2 Zn finger 208..228 CDD:275368 9/19 (47%)
zf-H2C2_2 221..244 CDD:290200 7/23 (30%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
zf-H2C2_2 251..273 CDD:290200 8/22 (36%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/36 (17%)
C2H2 Zn finger 103..123 CDD:275368 5/48 (10%)
COG5048 <112..288 CDD:227381 50/210 (24%)
C2H2 Zn finger 131..151 CDD:275368 5/19 (26%)
Chordopox_A33R 151..>254 CDD:283591 35/103 (34%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 5/19 (26%)
C2H2 Zn finger 216..236 CDD:275368 8/19 (42%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..290 CDD:275368 70/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.