Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008758154.1 | Gene: | Zfp771 / 308992 | RGDID: | 1305903 | Length: | 358 | Species: | Rattus norvegicus |
Alignment Length: | 265 | Identity: | 82/265 - (30%) |
---|---|---|---|
Similarity: | 122/265 - (46%) | Gaps: | 60/265 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 QQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDV 136
Fly 137 ACSADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAAS-----------------FTCNICN 184
Fly 185 NVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTR 249
Fly 250 IKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQ----LHHKNSH-- 308
Fly 309 EKSHK 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
C2H2 Zn finger | 180..200 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 201..>258 | CDD:227381 | 22/56 (39%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 11/21 (52%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 8/25 (32%) | ||
Zfp771 | XP_008758154.1 | COG5048 | <82..286 | CDD:227381 | 68/205 (33%) |
C2H2 Zn finger | 106..126 | CDD:275368 | 3/28 (11%) | ||
zf-H2C2_2 | 119..143 | CDD:290200 | 3/23 (13%) | ||
C2H2 Zn finger | 134..154 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 146..170 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 162..182 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 174..199 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 190..210 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 202..225 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 218..238 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 231..255 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 258..281 | CDD:290200 | 5/16 (31%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 82/265 (31%) | ||
zf-H2C2_2 | 286..309 | CDD:290200 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 139 | 1.000 | Inparanoid score | I4420 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |