DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and Zfp13

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	NP_001382483.1	Gene:	Zfp13 / 287095	RGDID:	1304577	Length:	538	Species:	Rattus norvegicus

Alignment Length:	135	Identity:	58/135 - (42%)
Similarity:	76/135 - (56%)	Gaps:	0/135 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   178 FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSR 242
            :.|:.|...::.|..|..|...|:..|||:|.||.|.|.|:..|..|..||||.:||.|..|...
  Rat   376 YVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICGKCFTQSSALVTHQRTHTGVKPYPCPECGKC 440

  Fly   243 FADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNS 307
            |:..|..|.|.|.||.|:||.|..|.:||.:|:.|..|.:||.|.||:||..|.||||:..:.:.
  Rat   441 FSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHR 505

  Fly   308 HEKSH 312
            |||.|
  Rat   506 HEKIH 510

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368	5/19 (26%)
		zf-H2C2_2	193..217	CDD:290200	11/23 (48%)
		COG5048	201..>258	CDD:227381	25/56 (45%)
		C2H2 Zn finger	208..228	CDD:275368	8/19 (42%)
		zf-H2C2_2	221..244	CDD:290200	10/22 (45%)
		C2H2 Zn finger	236..256	CDD:275368	7/19 (37%)
		zf-H2C2_2	251..273	CDD:290200	11/21 (52%)
		C2H2 Zn finger	264..284	CDD:275368	7/19 (37%)
		zf-H2C2_2	277..301	CDD:290200	13/23 (57%)
		C2H2 Zn finger	292..312	CDD:275368	9/19 (47%)
Zfp13	NP_001382483.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	139	1.000	Inparanoid score	I4420
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.960