DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF493

DIOPT Version :10

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_047294633.1 Gene:ZNF493 / 284443 HGNCID:23708 Length:775 Species:Homo sapiens


Alignment Length:326 Identity:87/326 - (26%)
Similarity:133/326 - (40%) Gaps:72/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAAL 65
            :||  :.:..:|..|....|:.|.:.|.       ||   :...|.|    ..|..|.       
Human   399 IHT--EEKSHRCEECGKAYKESSHLTTH-------KR---IHTGEKP----YKCEECG------- 440

  Fly    66 KLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTL 130
            |..|:.....|.           :|:|.|::..|..|.....|..:|          |..:.:..
Human   441 KTFSVFSILTKH-----------KIIHTEEKPYKCEECGKAFKRSST----------LTKHRIIH 484

  Fly   131 ESSEDVAC-------SADELVSIEPAISAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYS 188
            ...:...|       :....:||...|...|        ||             :.|..|...:.
Human   485 TEEKPYKCEECGKAFNQSSTLSIHKIIHTGE--------KP-------------YKCEECGKAFK 528

  Fly   189 ERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQ 253
            ....||.|..:|:.:||::||.|.|.|.::..|..|...|||::||||..|...|:..||..||:
Human   529 RSSTLTIHKMIHTGEKPYKCEECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHK 593

  Fly   254 RIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEV 318
            .|||:::|||||.|.::|..|::|.:|.|.||||:|:.|:.|.|:|.:..|...|::.|...|..
Human   594 IIHTDKKPYKCEECGKAFNRSSILSIHKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPY 658

  Fly   319 K 319
            |
Human   659 K 659

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:214871 10/44 (23%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
COG5048 201..>258 CDD:227381 24/56 (43%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:463886 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
zf-H2C2_2 251..271 CDD:463886 11/19 (58%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
ZNF493XP_047294633.1 KRAB 13..74 CDD:214630
C2H2 Zn finger 185..205 CDD:275368
C2H2 Zn finger 213..233 CDD:275368
C2H2 Zn finger 242..260 CDD:275368
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 352..372 CDD:275368
COG5048 362..762 CDD:227381 87/326 (27%)