DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ace2

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:48/180 - (26%)
Similarity:84/180 - (46%) Gaps:32/180 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 AISAPEES-VYSLSPKP-VTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKP------ 205
            |:|||.|| :.:..|:| :|.::|:         .:...:.|..:.:|..:..|.:|.|      
pombe   355 ALSAPYESCIVTKKPEPCITVKEEE---------QLAPKIESADLSITPQVTEHDSKPPVRISYD 410

  Fly   206 HECEICHKRFRQTPQLAR-----HMNTHTG---NRPYKCDY--CDSRFADPSTRIKHQRIHTNER 260
            |.|    |..:|:.::.|     ..:.:.|   :..|.|.|  |:.|.|.......|.:.|.::|
pombe   411 HRC----KTRKQSTRICRIPPETMASLYCGPEADGKYVCLYNGCNKRIARKYNVESHIQTHLSDR 471

  Fly   261 PYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEK 310
            ||:|:.|...|...:.|:.||:.|...||:.|: |.|.|::|...|.|::
pombe   472 PYRCDLCKAGFVRHHDLKRHLRIHENGRPYVCE-CLKRFNRLDALNRHKQ 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 2/19 (11%)
zf-H2C2_2 193..217 CDD:290200 7/29 (24%)
COG5048 201..>258 CDD:227381 16/72 (22%)
C2H2 Zn finger 208..228 CDD:275368 4/24 (17%)
zf-H2C2_2 221..244 CDD:290200 7/32 (22%)
C2H2 Zn finger 236..256 CDD:275368 6/21 (29%)
zf-H2C2_2 251..273 CDD:290200 8/21 (38%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
ace2NP_594109.1 COG5048 45..518 CDD:227381 47/176 (27%)
C2H2 Zn finger 448..467 CDD:275368 4/18 (22%)
zf-C2H2 473..495 CDD:278523 7/21 (33%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..511 CDD:290200 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.