DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and pag-3

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_510480.1 Gene:pag-3 / 181588 WormBaseID:WBGene00003909 Length:336 Species:Caenorhabditis elegans


Alignment Length:161 Identity:56/161 - (34%)
Similarity:86/161 - (53%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 APEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFR 216
            :|..||::.:|.|..       :...|.|..|..::|....|..|.:||.:.|..||:.|.|.|:
 Worm   107 SPSASVWNRTPTPPV-------EIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFK 164

  Fly   217 QTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHL 281
            ::..|:.|:..|:..|||.|:||..||...|...||..|||.|:|:||..|.::|..|:.|..|.
 Worm   165 RSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHT 229

  Fly   282 KTHTGERPFSCQYCQKSFSQLHHKNSHEKSH 312
            :.|||.:||:|..|.::|.:...:..|.:||
 Worm   230 RKHTGFKPFACDVCGRTFQRKVDRRRHRESH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 22/56 (39%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 11/21 (52%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 10/23 (43%)
C2H2 Zn finger 292..312 CDD:275368 4/19 (21%)
pag-3NP_510480.1 C2H2 Zn finger 128..148 CDD:275368 5/19 (26%)
zf-H2C2_2 140..165 CDD:290200 10/24 (42%)
zf-C2H2 154..176 CDD:278523 7/21 (33%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 164..>233 CDD:227381 26/68 (38%)
zf-H2C2_2 169..193 CDD:290200 11/23 (48%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 196..221 CDD:290200 11/24 (46%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..247 CDD:290200 9/22 (41%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2318
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.