DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and M03D4.4

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:199 Identity:64/199 - (32%)
Similarity:98/199 - (49%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 EYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVY-------SLSPKPVT-FEDEDSGQA 175
            |:|.::..|...:..||   .:|||..|:..|   |:|.:       .||..|.| .|...||:.
 Worm    27 EHETVEQGDQEEDRMED---DSDELAMIKIKI---EDSDFLSDTDSSQLSMNPTTPSEKSSSGEK 85

  Fly   176 ASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCD 240
            ..:.|..|:.:::.:.:|..||::||.::||.|..|.|.|.....|.:|...|||.|.:.|.:|:
 Worm    86 GRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCN 150

  Fly   241 SRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQL--- 302
            ..|.......:|..||:..||::|..|.::|.:...|..|:|.|. ||.||||.|.:||.:.   
 Worm   151 KAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQ-ERGFSCQQCGRSFLKQVML 214

  Fly   303 --HH 304
              ||
 Worm   215 DEHH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 11/23 (48%)
COG5048 201..>258 CDD:227381 19/56 (34%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 8/22 (36%)
C2H2 Zn finger 236..256 CDD:275368 4/19 (21%)
zf-H2C2_2 251..273 CDD:290200 8/21 (38%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 13/23 (57%)
C2H2 Zn finger 292..312 CDD:275368 7/18 (39%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/19 (26%)
zf-H2C2_2 102..127 CDD:290200 11/24 (46%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 4/19 (21%)
zf-H2C2_2 158..181 CDD:290200 7/22 (32%)
zf-C2H2 172..194 CDD:278523 6/21 (29%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.