| Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_493611.2 | Gene: | klu-1 / 173366 | WormBaseID: | WBGene00013970 | Length: | 543 | Species: | Caenorhabditis elegans |
| Alignment Length: | 227 | Identity: | 62/227 - (27%) |
|---|---|---|---|
| Similarity: | 96/227 - (42%) | Gaps: | 34/227 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 EKDLKEQKL---QEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDV 136
Fly 137 ACSADELVSIEPAISAPEE-SVYSLSPKPVTFEDEDSGQAA---SFTCNICNNVYSERVKLTNHM 197
Fly 198 ---------KVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQ 253
Fly 254 RIHTNERPYKCEFCSRSFGYSNVLRVHLKTHT 285 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
| C2H2 Zn finger | 180..200 | CDD:275368 | 4/28 (14%) | ||
| zf-H2C2_2 | 193..217 | CDD:290200 | 9/32 (28%) | ||
| COG5048 | 201..>258 | CDD:227381 | 22/56 (39%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 221..244 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 251..273 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 264..284 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 277..301 | CDD:290200 | 3/9 (33%) | ||
| C2H2 Zn finger | 292..312 | CDD:275368 | |||
| klu-1 | NP_493611.2 | C2H2 Zn finger | 334..354 | CDD:275368 | 4/19 (21%) |
| zf-C2H2 | 369..391 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 371..391 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 383..408 | CDD:290200 | 12/24 (50%) | ||
| COG5048 | 395..>448 | CDD:227381 | 17/52 (33%) | ||
| C2H2 Zn finger | 399..419 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 411..436 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 427..447 | CDD:275368 | 4/19 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||