DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and ZNF610

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001154897.1 Gene:ZNF610 / 162963 HGNCID:26687 Length:462 Species:Homo sapiens


Alignment Length:276 Identity:79/276 - (28%)
Similarity:124/276 - (44%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSD----SELEYEYL-DSYDVTLES--- 132
            |..:|..:.:..::||       |.|:.|:..::..||..    |..|.:.: :...:|||:   
Human    77 KQRREPLILQSQVKIV-------KNTDGRECVRSVNTGRSCVLGSNAENKPIKNQLGLTLEAHLS 134

  Fly   133 -------------SEDVACSADELVSIEPAISAPEESVYSLSPK--------PVTFEDEDS---G 173
                         |..|....:...|:.|...........:..|        |:..::|.:   |
Human   135 ELQLFQAGRKIYRSNQVEKFTNHRSSVSPLQKISSSFTTHIFNKYRNDLIDFPLLPQEEKAYIRG 199

  Fly   174 QAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDY 238
            ::..:.|:....|:..|..||||..:|:|:||::|..|.|.|.:...|..|...|||.:||||..
Human   200 KSYEYECSEDGEVFRVRASLTNHQVIHTAEKPYKCTECGKVFSRNSHLVEHWRIHTGQKPYKCSE 264

  Fly   239 CDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLH 303
            ||..|...|...:||||||.|:|:||..|.::|...:.|..||..||||:|:.|..|.|:|....
Human   265 CDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFRECSGLTTHLVIHTGEKPYKCNECGKNFRHKF 329

  Fly   304 HKNSHEKSHKRTKEVK 319
            ...:|::||...|..|
Human   330 SLTNHQRSHTAEKPYK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
zf-H2C2_2 193..217 CDD:290200 12/23 (52%)
COG5048 201..>258 CDD:227381 25/56 (45%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 11/22 (50%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 12/21 (57%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
ZNF610NP_001154897.1 KRAB 24..82 CDD:214630 1/4 (25%)
KRAB 24..63 CDD:279668
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
COG5048 217..>291 CDD:227381 34/73 (47%)
zf-H2C2_2 218..243 CDD:290200 12/24 (50%)
C2H2 Zn finger 234..254 CDD:275368 6/19 (32%)
zf-H2C2_2 246..271 CDD:290200 12/24 (50%)
COG5048 <257..446 CDD:227381 37/89 (42%)
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
zf-H2C2_2 274..297 CDD:290200 11/22 (50%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 303..327 CDD:290200 12/23 (52%)
zf-C2H2 316..338 CDD:278523 5/21 (24%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
zf-H2C2_2 330..354 CDD:290200 5/16 (31%)
C2H2 Zn finger 346..366 CDD:275368 79/276 (29%)
zf-H2C2_2 358..382 CDD:290200
C2H2 Zn finger 374..394 CDD:275368
zf-H2C2_2 387..411 CDD:290200
C2H2 Zn finger 402..422 CDD:275368
zf-H2C2_2 414..439 CDD:290200
C2H2 Zn finger 430..450 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.