Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001154897.1 | Gene: | ZNF610 / 162963 | HGNCID: | 26687 | Length: | 462 | Species: | Homo sapiens |
Alignment Length: | 276 | Identity: | 79/276 - (28%) |
---|---|---|---|
Similarity: | 124/276 - (44%) | Gaps: | 39/276 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 KDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSD----SELEYEYL-DSYDVTLES--- 132
Fly 133 -------------SEDVACSADELVSIEPAISAPEESVYSLSPK--------PVTFEDEDS---G 173
Fly 174 QAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDY 238
Fly 239 CDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLH 303
Fly 304 HKNSHEKSHKRTKEVK 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
C2H2 Zn finger | 180..200 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 12/23 (52%) | ||
COG5048 | 201..>258 | CDD:227381 | 25/56 (45%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 5/19 (26%) | ||
ZNF610 | NP_001154897.1 | KRAB | 24..82 | CDD:214630 | 1/4 (25%) |
KRAB | 24..63 | CDD:279668 | |||
C2H2 Zn finger | 206..226 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 217..>291 | CDD:227381 | 34/73 (47%) | ||
zf-H2C2_2 | 218..243 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 234..254 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 246..271 | CDD:290200 | 12/24 (50%) | ||
COG5048 | <257..446 | CDD:227381 | 37/89 (42%) | ||
zf-C2H2 | 260..282 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 274..297 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 290..310 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 303..327 | CDD:290200 | 12/23 (52%) | ||
zf-C2H2 | 316..338 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 330..354 | CDD:290200 | 5/16 (31%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 79/276 (29%) | ||
zf-H2C2_2 | 358..382 | CDD:290200 | |||
C2H2 Zn finger | 374..394 | CDD:275368 | |||
zf-H2C2_2 | 387..411 | CDD:290200 | |||
C2H2 Zn finger | 402..422 | CDD:275368 | |||
zf-H2C2_2 | 414..439 | CDD:290200 | |||
C2H2 Zn finger | 430..450 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |