| Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011544054.1 | Gene: | ZNF785 / 146540 | HGNCID: | 26496 | Length: | 418 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 75/233 - (32%) |
|---|---|---|---|
| Similarity: | 103/233 - (44%) | Gaps: | 36/233 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 110 EATGSDSELEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFED----- 169
Fly 170 -----EDSGQAAS-----------------FTCNICNNVYSERVKLTNHMKVHSAKKPHECEICH 212
Fly 213 KRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVL 277
Fly 278 RVHLKTHTGERPFSCQYCQKSFSQ----LHHKNSHEKS 311 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
| C2H2 Zn finger | 180..200 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 193..217 | CDD:290200 | 9/23 (39%) | ||
| COG5048 | 201..>258 | CDD:227381 | 26/56 (46%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 221..244 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 251..273 | CDD:290200 | 12/21 (57%) | ||
| C2H2 Zn finger | 264..284 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 277..301 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 292..312 | CDD:275368 | 7/24 (29%) | ||
| ZNF785 | XP_011544054.1 | KRAB | 29..102 | CDD:214630 | |
| COG5048 | <156..372 | CDD:227381 | 66/195 (34%) | ||
| C2H2 Zn finger | 187..207 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 215..235 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 243..263 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 271..291 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 299..319 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 355..375 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||