Sequence 1: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001252526.1 | Gene: | ZNF211 / 10520 | HGNCID: | 13003 | Length: | 629 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 73/228 - (32%) |
---|---|---|---|
Similarity: | 106/228 - (46%) | Gaps: | 22/228 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 QETKKKTESRDLSKNEATGSDSELEYEYLDSYDV--TLESSE-DVACSADELVSIEPAISAPEES 156
Fly 157 VYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQL 221
Fly 222 ARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTG 286
Fly 287 ERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | |
C2H2 Zn finger | 180..200 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 201..>258 | CDD:227381 | 22/56 (39%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 7/19 (37%) | ||
ZNF211 | NP_001252526.1 | KRAB | 46..106 | CDD:214630 | |
KRAB | 46..85 | CDD:279668 | |||
COG5048 | 244..615 | CDD:227381 | 73/228 (32%) | ||
C2H2 Zn finger | 299..316 | CDD:275368 | |||
C2H2 Zn finger | 324..344 | CDD:275368 | 2/4 (50%) | ||
zf-H2C2_2 | 336..361 | CDD:290200 | 6/26 (23%) | ||
C2H2 Zn finger | 352..372 | CDD:275368 | 4/24 (17%) | ||
zf-H2C2_2 | 368..389 | CDD:290200 | 4/29 (14%) | ||
C2H2 Zn finger | 380..400 | CDD:275368 | 5/28 (18%) | ||
zf-H2C2_2 | 392..417 | CDD:290200 | 5/29 (17%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 420..445 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 464..484 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 518..540 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 520..540 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 532..557 | CDD:290200 | 3/16 (19%) | ||
C2H2 Zn finger | 548..568 | CDD:275368 | 73/228 (32%) | ||
zf-H2C2_2 | 560..585 | CDD:290200 | |||
C2H2 Zn finger | 576..596 | CDD:275368 | |||
zf-H2C2_2 | 588..611 | CDD:290200 | |||
C2H2 Zn finger | 604..624 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |