DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4854 and LOC103691238

DIOPT Version :9

Sequence 1:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_008758162.1 Gene:LOC103691238 / 103691238 RGDID:9074604 Length:337 Species:Rattus norvegicus


Alignment Length:155 Identity:57/155 - (36%)
Similarity:84/155 - (54%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 YSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLA 222
            :|||..........|| .....|..|...:.....|..|.:||:.:||:.|..|.|.||.:..|.
  Rat   153 FSLSSNLTKHRRSHSG-LRPHKCMECGEAFGRSADLAKHQRVHTGEKPYACAECGKTFRVSSNLI 216

  Fly   223 RHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGE 287
            :|..||||.:||:|..|...|:..|..::|||.||.|:||.|.:|..|||.|:.|..|.::||||
  Rat   217 QHQRTHTGEKPYRCGLCGKSFSLSSNLLQHQRCHTGEKPYFCAWCGDSFGRSSYLLEHQRSHTGE 281

  Fly   288 RPFSCQYCQKSFSQLHHKNSHEKSH 312
            :|::|..|.|:|:...:...|:::|
  Rat   282 KPYNCCECGKNFTNSSNCLRHQRTH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 23/56 (41%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
zf-H2C2_2 251..273 CDD:290200 12/21 (57%)
C2H2 Zn finger 264..284 CDD:275368 8/19 (42%)
zf-H2C2_2 277..301 CDD:290200 11/23 (48%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
LOC103691238XP_008758162.1 C2H2 Zn finger 90..110 CDD:275368
COG5048 <111..270 CDD:227381 44/117 (38%)
C2H2 Zn finger 118..138 CDD:275368
C2H2 Zn finger 146..166 CDD:275368 3/12 (25%)
C2H2 Zn finger 174..194 CDD:275368 4/19 (21%)
C2H2 Zn finger 202..222 CDD:275368 7/19 (37%)
C2H2 Zn finger 230..250 CDD:275368 7/19 (37%)
COG5048 254..>314 CDD:227381 21/53 (40%)
C2H2 Zn finger 258..278 CDD:275368 8/19 (42%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4420
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.