DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4854 and Znf48

DIOPT Version :9

Sequence 1:	NP_650860.1	Gene:	CG4854 / 42391	FlyBaseID:	FBgn0038766	Length:	319	Species:	Drosophila melanogaster
Sequence 2:	XP_008758156.1	Gene:	Znf48 / 103690203	RGDID:	9115869	Length:	590	Species:	Rattus norvegicus

Alignment Length:	130	Identity:	50/130 - (38%)
Similarity:	64/130 - (49%)	Gaps:	24/130 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   208 CEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYK--------- 263
            |..|.|.|||...|.:|..||||.:||||..|...|.|.|.||||||.||.|:||:
  Rat    85 CGECGKSFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHTGEKPYRVRPPAPGPP 149

  Fly   264 ---------------CEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHK 313
                           |..|.:||..|:.|..|.:|||||:|:.|..|.|.|.....:..|:::|:
  Rat   150 KMPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQRTHR 214

Fly 314 313
Rat 215 214

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4854	NP_650860.1	zf-AD	12..>57	CDD:285071
		C2H2 Zn finger	180..200	CDD:275368
		zf-H2C2_2	193..217	CDD:290200	4/8 (50%)
		COG5048	201..>258	CDD:227381	27/49 (55%)
		C2H2 Zn finger	208..228	CDD:275368	8/19 (42%)
		zf-H2C2_2	221..244	CDD:290200	11/22 (50%)
		C2H2 Zn finger	236..256	CDD:275368	11/19 (58%)
		zf-H2C2_2	251..273	CDD:290200	13/45 (29%)
		C2H2 Zn finger	264..284	CDD:275368	7/19 (37%)
		zf-H2C2_2	277..301	CDD:290200	12/23 (52%)
		C2H2 Zn finger	292..312	CDD:275368	5/19 (26%)
Znf48	XP_008758156.1	zf-C2H2	84..105	CDD:278523	8/19 (42%)
		COG5048	85..471	CDD:227381	50/130 (38%)
		C2H2 Zn finger	85..105	CDD:275368	8/19 (42%)
		zf-H2C2_2	97..120	CDD:290200	11/22 (50%)
		C2H2 Zn finger	113..133	CDD:275368	11/19 (58%)
		C2H2 Zn finger	165..185	CDD:275368	7/19 (37%)
		zf-C2H2	165..185	CDD:278523	7/19 (37%)
		zf-H2C2_2	177..200	CDD:290200	11/22 (50%)
		C2H2 Zn finger	193..213	CDD:275368	5/19 (26%)
		C2H2 Zn finger	248..268	CDD:275368
		C2H2 Zn finger	276..296	CDD:275368
		zf-H2C2_2	288..312	CDD:290200
		C2H2 Zn finger	304..324	CDD:275368
		zf-H2C2_2	319..340	CDD:290200
		C2H2 Zn finger	332..352	CDD:275368
		zf-C2H2	423..445	CDD:278523
		C2H2 Zn finger	425..445	CDD:275368
		zf-H2C2_2	437..461	CDD:290200
		C2H2 Zn finger	453..537	CDD:275368
		COG5048	495..>563	CDD:227381
		zf-C2H2	515..537	CDD:278523
		zf-H2C2_2	529..552	CDD:290200
		C2H2 Zn finger	545..565	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000